BLASTX nr result
ID: Rehmannia32_contig00003846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003846 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythra... 58 3e-07 ref|XP_012856439.1| PREDICTED: subtilisin-like protease SBT1.7 [... 58 3e-07 ref|XP_011072593.1| subtilisin-like protease SBT1.4 [Sesamum ind... 57 8e-07 >gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata] Length = 777 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 FGSIEWSDGGSHRVRSPVAVVWRLSSAVAM 92 FGSIEWSDGGSH VRSP+A VWR SSAVAM Sbjct: 748 FGSIEWSDGGSHLVRSPIAAVWRTSSAVAM 777 >ref|XP_012856439.1| PREDICTED: subtilisin-like protease SBT1.7 [Erythranthe guttata] Length = 783 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 FGSIEWSDGGSHRVRSPVAVVWRLSSAVAM 92 FGSIEWSDGGSH VRSP+A VWR SSAVAM Sbjct: 754 FGSIEWSDGGSHLVRSPIAAVWRTSSAVAM 783 >ref|XP_011072593.1| subtilisin-like protease SBT1.4 [Sesamum indicum] Length = 774 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FGSIEWSDGGSHRVRSPVAVVWRLSSAVAM 92 FGSIEWSDGGSH VRSP+AV+WR +SAVAM Sbjct: 745 FGSIEWSDGGSHLVRSPIAVLWRRNSAVAM 774