BLASTX nr result
ID: Rehmannia32_contig00003776
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003776 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093011.1| cytochrome b5 [Sesamum indicum] 59 1e-08 >ref|XP_011093011.1| cytochrome b5 [Sesamum indicum] Length = 131 Score = 59.3 bits (142), Expect = 1e-08 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -3 Query: 378 FLIGDIDESTLPVKQHDATPTISPTANRGSGDSSRXXXXXXXXXXLGVAFLMRFYS 211 F IG+ID+STLPVKQ PT+S TAN SGDSS+ L VAFL+RFYS Sbjct: 73 FYIGEIDKSTLPVKQSYTPPTVSSTANLDSGDSSKILLYIVPLLILTVAFLLRFYS 128