BLASTX nr result
ID: Rehmannia32_contig00003775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003775 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093011.1| cytochrome b5 [Sesamum indicum] 60 4e-09 >ref|XP_011093011.1| cytochrome b5 [Sesamum indicum] Length = 131 Score = 60.5 bits (145), Expect = 4e-09 Identities = 33/56 (58%), Positives = 37/56 (66%) Frame = -3 Query: 376 FLIGDIDESTLPVKQHDATPTISPTANRGSGDSSKXXXXXXXXXXLGVAFLMRFYS 209 F IG+ID+STLPVKQ PT+S TAN SGDSSK L VAFL+RFYS Sbjct: 73 FYIGEIDKSTLPVKQSYTPPTVSSTANLDSGDSSKILLYIVPLLILTVAFLLRFYS 128