BLASTX nr result
ID: Rehmannia32_contig00003568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003568 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKH63240.1| hypothetical protein CRG98_050261 [Punica granatum] 57 7e-08 >gb|PKH63240.1| hypothetical protein CRG98_050261 [Punica granatum] Length = 92 Score = 56.6 bits (135), Expect = 7e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 4 MALRLLYGLVFLSFSTACFLCLHLILQPVFYFTS 105 MALR++YGLVFLSFS ACF LHL L+PVFY TS Sbjct: 59 MALRIVYGLVFLSFSCACFKILHLFLRPVFYLTS 92