BLASTX nr result
ID: Rehmannia32_contig00003448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003448 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828131.1| PREDICTED: eukaryotic translation initiation... 115 1e-27 gb|PIN21025.1| Translation initiation factor 3, subunit e (eIF-3... 114 1e-27 gb|PON38926.1| Eukaryotic translation initiation factor 3 subuni... 110 8e-27 ref|XP_021602845.1| eukaryotic translation initiation factor 3 s... 105 8e-27 dbj|GAU34347.1| hypothetical protein TSUD_20540 [Trifolium subte... 108 9e-27 ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation... 112 1e-26 gb|KHN41695.1| Eukaryotic translation initiation factor 3 subuni... 112 1e-26 gb|PON35000.1| Eukaryotic translation initiation factor 3 subuni... 109 2e-26 ref|XP_021603118.1| eukaryotic translation initiation factor 3 s... 103 2e-26 ref|XP_023887589.1| eukaryotic translation initiation factor 3 s... 111 3e-26 ref|XP_011078923.1| eukaryotic translation initiation factor 3 s... 111 3e-26 ref|XP_014514864.1| eukaryotic translation initiation factor 3 s... 110 4e-26 ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phas... 110 4e-26 gb|ACU17653.1| unknown [Glycine max] 108 5e-26 ref|XP_022570322.1| eukaryotic translation initiation factor 3 s... 102 7e-26 gb|OAY21617.1| hypothetical protein MANES_S071900 [Manihot escul... 101 9e-26 gb|PIN02503.1| Translation initiation factor 3, subunit e (eIF-3... 109 1e-25 ref|XP_020210534.1| eukaryotic translation initiation factor 3 s... 109 1e-25 ref|XP_012857396.1| PREDICTED: eukaryotic translation initiation... 109 1e-25 ref|XP_023751804.1| eukaryotic translation initiation factor 3 s... 109 1e-25 >ref|XP_012828131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E-like [Erythranthe guttata] gb|EYU18691.1| hypothetical protein MIMGU_mgv1a006587mg [Erythranthe guttata] Length = 438 Score = 115 bits (287), Expect = 1e-27 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 +NLIRTSKLEAK+DSETGTI+MEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQ Q A Sbjct: 378 LNLIRTSKLEAKIDSETGTIIMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQTQAA 437 Query: 183 R 185 R Sbjct: 438 R 438 >gb|PIN21025.1| Translation initiation factor 3, subunit e (eIF-3e) [Handroanthus impetiginosus] Length = 438 Score = 114 bits (286), Expect = 1e-27 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIRTSKLEAK+DSETGTIV+EPN TNVYEQLIDHTKALSGRTYKLVSQLLEHAQ QTA Sbjct: 378 VNLIRTSKLEAKIDSETGTIVIEPNQTNVYEQLIDHTKALSGRTYKLVSQLLEHAQAQTA 437 Query: 183 R 185 R Sbjct: 438 R 438 >gb|PON38926.1| Eukaryotic translation initiation factor 3 subunit E [Trema orientalis] Length = 301 Score = 110 bits (275), Expect = 8e-27 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQT 179 VNLIRTSKL+AK+DS+TGT+VMEPNH NVYEQLIDHTKALSGRTYKLVSQ+L+HAQGQT Sbjct: 240 VNLIRTSKLDAKIDSKTGTVVMEPNHPNVYEQLIDHTKALSGRTYKLVSQVLQHAQGQT 298 >ref|XP_021602845.1| eukaryotic translation initiation factor 3 subunit E-like [Manihot esculenta] Length = 105 Score = 105 bits (261), Expect = 8e-27 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR SKL+AK+DS++GT++MEPN NVYEQLIDHTKA+SGRTYKLV QLLEHAQ QTA Sbjct: 45 VNLIRNSKLDAKIDSQSGTVIMEPNQPNVYEQLIDHTKAISGRTYKLVGQLLEHAQAQTA 104 Query: 183 R 185 R Sbjct: 105 R 105 >dbj|GAU34347.1| hypothetical protein TSUD_20540 [Trifolium subterraneum] Length = 240 Score = 108 bits (271), Expect = 9e-27 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR SKL+AK+DSETGT++MEPNH NVYEQ+IDHTKAL+GRTYKLV+QLLEHAQ QTA Sbjct: 180 VNLIRGSKLDAKIDSETGTVIMEPNHPNVYEQVIDHTKALNGRTYKLVTQLLEHAQAQTA 239 Query: 183 R 185 R Sbjct: 240 R 240 >ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E [Glycine max] gb|KRH72039.1| hypothetical protein GLYMA_02G187100 [Glycine max] Length = 437 Score = 112 bits (280), Expect = 1e-26 Identities = 53/61 (86%), Positives = 59/61 (96%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DSETGT++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQ QTA Sbjct: 377 VNLIRSSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQTA 436 Query: 183 R 185 R Sbjct: 437 R 437 >gb|KHN41695.1| Eukaryotic translation initiation factor 3 subunit E [Glycine soja] Length = 448 Score = 112 bits (280), Expect = 1e-26 Identities = 53/61 (86%), Positives = 59/61 (96%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DSETGT++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQ QTA Sbjct: 388 VNLIRSSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQTA 447 Query: 183 R 185 R Sbjct: 448 R 448 >gb|PON35000.1| Eukaryotic translation initiation factor 3 subunit E [Parasponia andersonii] Length = 301 Score = 109 bits (272), Expect = 2e-26 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQT 179 VNLIRTSKL+AKVDS+TGT+VMEPNH NVYEQLIDHTKALSGRTYKLV Q+L+HAQGQT Sbjct: 240 VNLIRTSKLDAKVDSKTGTVVMEPNHLNVYEQLIDHTKALSGRTYKLVGQVLQHAQGQT 298 >ref|XP_021603118.1| eukaryotic translation initiation factor 3 subunit E-like [Manihot esculenta] Length = 80 Score = 103 bits (256), Expect = 2e-26 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR SKL+AK+DS++GT++MEPN NVYEQLIDHTKA+SGRTYKLV QLLEHAQ Q A Sbjct: 20 VNLIRNSKLDAKIDSQSGTVIMEPNQPNVYEQLIDHTKAISGRTYKLVGQLLEHAQAQAA 79 Query: 183 R 185 R Sbjct: 80 R 80 >ref|XP_023887589.1| eukaryotic translation initiation factor 3 subunit E [Quercus suber] gb|POE67225.1| eukaryotic translation initiation factor 3 subunit e [Quercus suber] Length = 437 Score = 111 bits (277), Expect = 3e-26 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR SKL+AK+DSE+GT+VMEPNH NVYEQLIDHTKALSGRTYKLVSQLLEHAQ QTA Sbjct: 377 VNLIRGSKLDAKIDSESGTVVMEPNHPNVYEQLIDHTKALSGRTYKLVSQLLEHAQAQTA 436 Query: 183 R 185 R Sbjct: 437 R 437 >ref|XP_011078923.1| eukaryotic translation initiation factor 3 subunit E [Sesamum indicum] Length = 438 Score = 111 bits (277), Expect = 3e-26 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIRTSKLEAK+DS+TGTI+MEPNH NVYEQLIDHTKALSGRTYKLVSQLLEHAQ Q Sbjct: 378 VNLIRTSKLEAKIDSKTGTILMEPNHANVYEQLIDHTKALSGRTYKLVSQLLEHAQAQVT 437 Query: 183 R 185 R Sbjct: 438 R 438 >ref|XP_014514864.1| eukaryotic translation initiation factor 3 subunit E [Vigna radiata var. radiata] ref|XP_014514866.1| eukaryotic translation initiation factor 3 subunit E [Vigna radiata var. radiata] ref|XP_017415556.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E [Vigna angularis] ref|XP_017415557.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E [Vigna angularis] ref|XP_022640382.1| eukaryotic translation initiation factor 3 subunit E [Vigna radiata var. radiata] gb|KOM34228.1| hypothetical protein LR48_Vigan02g037800 [Vigna angularis] dbj|BAT96332.1| hypothetical protein VIGAN_08325000 [Vigna angularis var. angularis] Length = 437 Score = 110 bits (276), Expect = 4e-26 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DS TGT++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQGQ A Sbjct: 377 VNLIRSSKLDAKIDSHTGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQGQAA 436 Query: 183 R 185 R Sbjct: 437 R 437 >ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris] gb|ESW17569.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris] Length = 437 Score = 110 bits (276), Expect = 4e-26 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DS TGT++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQGQ A Sbjct: 377 VNLIRSSKLDAKIDSHTGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQGQAA 436 Query: 183 R 185 R Sbjct: 437 R 437 >gb|ACU17653.1| unknown [Glycine max] Length = 323 Score = 108 bits (271), Expect = 5e-26 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DSETG ++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQ QT Sbjct: 263 VNLIRSSKLDAKIDSETGAVIMEPNHLNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQTT 322 Query: 183 R 185 R Sbjct: 323 R 323 >ref|XP_022570322.1| eukaryotic translation initiation factor 3 subunit E-like [Brassica napus] Length = 80 Score = 102 bits (253), Expect = 7e-26 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIRTSKL+AK+DSE+GT++MEP NV+EQLI+HTKALSGRTYKLV+QLLEH QGQ A Sbjct: 20 VNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTKALSGRTYKLVTQLLEHTQGQAA 79 Query: 183 R 185 R Sbjct: 80 R 80 >gb|OAY21617.1| hypothetical protein MANES_S071900 [Manihot esculenta] Length = 80 Score = 101 bits (252), Expect = 9e-26 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR SKL+AK+DS++GT++MEPN NVYEQLIDHTKA+SGRTYKLV QLLEHAQ Q Sbjct: 20 VNLIRNSKLDAKIDSQSGTVIMEPNQPNVYEQLIDHTKAISGRTYKLVGQLLEHAQAQAV 79 Query: 183 R 185 R Sbjct: 80 R 80 >gb|PIN02503.1| Translation initiation factor 3, subunit e (eIF-3e) [Handroanthus impetiginosus] Length = 438 Score = 109 bits (273), Expect = 1e-25 Identities = 54/61 (88%), Positives = 55/61 (90%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIRTSKLEAK+DS TGTIVMEPNH NVYEQLIDHT ALSGRTYKLVSQLLEHAQ Q Sbjct: 378 VNLIRTSKLEAKIDSNTGTIVMEPNHPNVYEQLIDHTNALSGRTYKLVSQLLEHAQAQAT 437 Query: 183 R 185 R Sbjct: 438 R 438 >ref|XP_020210534.1| eukaryotic translation initiation factor 3 subunit E [Cajanus cajan] gb|KYP73690.1| Eukaryotic translation initiation factor 3 subunit E [Cajanus cajan] Length = 437 Score = 109 bits (272), Expect = 1e-25 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIR+SKL+AK+DS+TGT++MEPNH NVYEQLIDHTKAL+GRTYKLVSQLLEHAQ Q A Sbjct: 377 VNLIRSSKLDAKIDSQTGTVIMEPNHPNVYEQLIDHTKALNGRTYKLVSQLLEHAQAQVA 436 Query: 183 R 185 R Sbjct: 437 R 437 >ref|XP_012857396.1| PREDICTED: eukaryotic translation initiation factor 3 subunit E [Erythranthe guttata] gb|EYU20768.1| hypothetical protein MIMGU_mgv1a006585mg [Erythranthe guttata] Length = 438 Score = 109 bits (272), Expect = 1e-25 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 VNLIRTSKLEAK+D++TGTI+MEPNHTNVYEQLIDHTKALSGRTYKLVSQL+EHAQ Q Sbjct: 378 VNLIRTSKLEAKLDTKTGTIMMEPNHTNVYEQLIDHTKALSGRTYKLVSQLMEHAQVQAT 437 Query: 183 R 185 R Sbjct: 438 R 438 >ref|XP_023751804.1| eukaryotic translation initiation factor 3 subunit E [Lactuca sativa] gb|PLY94610.1| hypothetical protein LSAT_8X117161 [Lactuca sativa] Length = 439 Score = 109 bits (272), Expect = 1e-25 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = +3 Query: 3 VNLIRTSKLEAKVDSETGTIVMEPNHTNVYEQLIDHTKALSGRTYKLVSQLLEHAQGQTA 182 +NLIRTSKL+AK+D++TGT+VMEPNH NVYEQLIDHTK LSGRTYKLVSQLLEH+Q QTA Sbjct: 379 LNLIRTSKLDAKIDTQTGTVVMEPNHPNVYEQLIDHTKGLSGRTYKLVSQLLEHSQAQTA 438 Query: 183 R 185 R Sbjct: 439 R 439