BLASTX nr result
ID: Rehmannia32_contig00003168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003168 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019188503.1| PREDICTED: MLO-like protein 1 [Ipomoea nil] 74 9e-12 gb|KDO49756.1| hypothetical protein CISIN_1g0113632mg, partial [... 72 2e-11 gb|ESR55224.1| hypothetical protein CICLE_v10020313mg [Citrus cl... 72 3e-11 ref|XP_015385823.1| PREDICTED: MLO-like protein 1 isoform X2 [Ci... 72 3e-11 ref|XP_006478537.1| PREDICTED: MLO-like protein 1 isoform X1 [Ci... 72 3e-11 gb|KZV34418.1| MLO-like protein 1-like [Dorcoceras hygrometricum] 71 6e-11 gb|OAY76248.1| MLO-like protein 1 [Ananas comosus] 65 1e-10 ref|XP_002533335.2| PREDICTED: LOW QUALITY PROTEIN: MLO-like pro... 70 2e-10 gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis] 70 2e-10 ref|XP_022847099.1| MLO-like protein 1 [Olea europaea var. sylve... 70 2e-10 ref|XP_010040798.1| PREDICTED: MLO-like protein 1 [Eucalyptus gr... 69 3e-10 gb|PPD96365.1| hypothetical protein GOBAR_DD06594 [Gossypium bar... 69 3e-10 ref|XP_010277858.1| PREDICTED: MLO-like protein 1 [Nelumbo nucif... 69 3e-10 emb|CDP04006.1| unnamed protein product [Coffea canephora] 69 4e-10 gb|KHG04571.1| MLO-like protein 1 [Gossypium arboreum] 69 5e-10 gb|PPR83300.1| hypothetical protein GOBAR_AA37409 [Gossypium bar... 69 5e-10 gb|PPR94996.1| hypothetical protein GOBAR_AA25671 [Gossypium bar... 69 5e-10 gb|KHG28287.1| MLO-like protein 1 [Gossypium arboreum] 69 5e-10 ref|XP_016726032.1| PREDICTED: MLO-like protein 1 [Gossypium hir... 69 5e-10 ref|XP_012463761.1| PREDICTED: MLO-like protein 1 [Gossypium rai... 69 5e-10 >ref|XP_019188503.1| PREDICTED: MLO-like protein 1 [Ipomoea nil] Length = 501 Score = 73.6 bits (179), Expect = 9e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +++ + HSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP Sbjct: 216 IILGWLHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 253 >gb|KDO49756.1| hypothetical protein CISIN_1g0113632mg, partial [Citrus sinensis] Length = 348 Score = 72.0 bits (175), Expect = 2e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFYGSVTKSDYT LRLGFIMTHCRGNP Sbjct: 86 VLMGWLHSFFKQFYGSVTKSDYTTLRLGFIMTHCRGNP 123 >gb|ESR55224.1| hypothetical protein CICLE_v10020313mg [Citrus clementina] Length = 421 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L HSFFKQFYGSVTKSDYT LRLGFIMTHCRGNP Sbjct: 159 VLAVVHHSFFKQFYGSVTKSDYTTLRLGFIMTHCRGNP 196 >ref|XP_015385823.1| PREDICTED: MLO-like protein 1 isoform X2 [Citrus sinensis] Length = 486 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFYGSVTKSDYT LRLGFIMTHCRGNP Sbjct: 224 VLMGWLHSFFKQFYGSVTKSDYTTLRLGFIMTHCRGNP 261 >ref|XP_006478537.1| PREDICTED: MLO-like protein 1 isoform X1 [Citrus sinensis] Length = 487 Score = 72.0 bits (175), Expect = 3e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFYGSVTKSDYT LRLGFIMTHCRGNP Sbjct: 225 VLMGWLHSFFKQFYGSVTKSDYTTLRLGFIMTHCRGNP 262 >gb|KZV34418.1| MLO-like protein 1-like [Dorcoceras hygrometricum] Length = 619 Score = 71.2 bits (173), Expect = 6e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + H FFKQFYGSVTK+DYTALRLGFIMTHCRGNP Sbjct: 223 VLLSWLHCFFKQFYGSVTKTDYTALRLGFIMTHCRGNP 260 >gb|OAY76248.1| MLO-like protein 1 [Ananas comosus] Length = 88 Score = 65.5 bits (158), Expect = 1e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 LL +H+FFKQFYGSVTKSDYT +RLGFIM HC GNP Sbjct: 36 LLGTVKHAFFKQFYGSVTKSDYTTMRLGFIMNHCPGNP 73 >ref|XP_002533335.2| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 1 [Ricinus communis] Length = 495 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 472 LIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 L+ + HSFFKQFYGSVTKSDY LRLGFIMTHCRGNP Sbjct: 220 LLGWVHSFFKQFYGSVTKSDYITLRLGFIMTHCRGNP 256 >gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis] Length = 507 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 472 LIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 L+ + HSFFKQFYGSVTKSDY LRLGFIMTHCRGNP Sbjct: 224 LLGWVHSFFKQFYGSVTKSDYITLRLGFIMTHCRGNP 260 >ref|XP_022847099.1| MLO-like protein 1 [Olea europaea var. sylvestris] Length = 508 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +1 Query: 448 GVTAEC*LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 GV LL + Q SFFKQFYGSVTKSDY+ALRLGFIMTHCRGNP Sbjct: 216 GVEKHSALLSWLQ-SFFKQFYGSVTKSDYSALRLGFIMTHCRGNP 259 >ref|XP_010040798.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis] Length = 517 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 487 HSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 HSFFKQFYGSVTKSDYT LRLGFIM HCRGNP Sbjct: 229 HSFFKQFYGSVTKSDYTTLRLGFIMAHCRGNP 260 >gb|PPD96365.1| hypothetical protein GOBAR_DD06594 [Gossypium barbadense] Length = 311 Score = 68.6 bits (166), Expect = 3e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 93 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 130 >ref|XP_010277858.1| PREDICTED: MLO-like protein 1 [Nelumbo nucifera] Length = 498 Score = 68.9 bits (167), Expect = 3e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 487 HSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 HSFFKQFYGSVTKSDY LRLGFIMTHCRGNP Sbjct: 227 HSFFKQFYGSVTKSDYITLRLGFIMTHCRGNP 258 >emb|CDP04006.1| unnamed protein product [Coffea canephora] Length = 468 Score = 68.6 bits (166), Expect = 4e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +1 Query: 445 LGVTAEC*LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 LG+ +L +F HSF KQFYGSVTKSDY ALRLGFIMTHCRGNP Sbjct: 211 LGLERHSRILGWF-HSFCKQFYGSVTKSDYVALRLGFIMTHCRGNP 255 >gb|KHG04571.1| MLO-like protein 1 [Gossypium arboreum] Length = 485 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 216 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 253 >gb|PPR83300.1| hypothetical protein GOBAR_AA37409 [Gossypium barbadense] Length = 495 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 229 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 266 >gb|PPR94996.1| hypothetical protein GOBAR_AA25671 [Gossypium barbadense] Length = 496 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 229 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 266 >gb|KHG28287.1| MLO-like protein 1 [Gossypium arboreum] Length = 503 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 216 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 253 >ref|XP_016726032.1| PREDICTED: MLO-like protein 1 [Gossypium hirsutum] ref|XP_016726040.1| PREDICTED: MLO-like protein 1 [Gossypium hirsutum] ref|XP_016726048.1| PREDICTED: MLO-like protein 1 [Gossypium hirsutum] ref|XP_016726055.1| PREDICTED: MLO-like protein 1 [Gossypium hirsutum] ref|XP_016726064.1| PREDICTED: MLO-like protein 1 [Gossypium hirsutum] Length = 504 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 229 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 266 >ref|XP_012463761.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] ref|XP_012463762.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] ref|XP_012463763.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] ref|XP_012463765.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] ref|XP_012463766.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] ref|XP_012463767.1| PREDICTED: MLO-like protein 1 [Gossypium raimondii] gb|KJB82477.1| hypothetical protein B456_013G197800 [Gossypium raimondii] gb|KJB82478.1| hypothetical protein B456_013G197800 [Gossypium raimondii] gb|KJB82479.1| hypothetical protein B456_013G197800 [Gossypium raimondii] gb|KJB82480.1| hypothetical protein B456_013G197800 [Gossypium raimondii] gb|KJB82481.1| hypothetical protein B456_013G197800 [Gossypium raimondii] Length = 504 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 469 LLIYFQHSFFKQFYGSVTKSDYTALRLGFIMTHCRGNP 582 +L+ + HSFFKQFY SVTKSDY LRLGFIMTHCRGNP Sbjct: 229 ILLGWVHSFFKQFYASVTKSDYVTLRLGFIMTHCRGNP 266