BLASTX nr result
ID: Rehmannia32_contig00001928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00001928 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21417.1| Acyl-CoA-binding protein [Handroanthus impetigino... 55 3e-15 ref|XP_004234986.1| PREDICTED: acyl-CoA-binding domain-containin... 45 2e-09 ref|XP_006350518.1| PREDICTED: acyl-CoA-binding domain-containin... 45 3e-09 ref|XP_011084528.1| acyl-CoA-binding domain-containing protein 1... 57 1e-08 ref|XP_015067401.1| PREDICTED: acyl-CoA-binding domain-containin... 45 4e-08 ref|XP_016446270.1| PREDICTED: acyl-CoA-binding domain-containin... 45 1e-07 ref|XP_009773322.1| PREDICTED: acyl-CoA-binding domain-containin... 45 1e-07 ref|XP_019200430.1| PREDICTED: acyl-CoA-binding domain-containin... 46 1e-07 ref|XP_019237641.1| PREDICTED: acyl-CoA-binding domain-containin... 45 3e-07 >gb|PIN21417.1| Acyl-CoA-binding protein [Handroanthus impetiginosus] Length = 352 Score = 55.5 bits (132), Expect(4) = 3e-15 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +3 Query: 135 NLRVTRSHQTEAESEPEFDEKSLSSSI--LEENEPLVGVNE 251 NLR+TRSHQTE ESEP+ + KS SS LEENEPL+G NE Sbjct: 35 NLRITRSHQTEGESEPQLEGKSQGSSARNLEENEPLIGGNE 75 Score = 47.0 bits (110), Expect(4) = 3e-15 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAMQ YID+VTEL Sbjct: 163 QAWQKLGAMPPEEAMQKYIDIVTEL 187 Score = 24.6 bits (52), Expect(4) = 3e-15 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQ++ +V FG+ Sbjct: 1 MADWQQFVQSVVFGL 15 Score = 21.2 bits (43), Expect(4) = 3e-15 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 27/50 (54%) Frame = +2 Query: 320 AFVTATAAP----KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSN+ ALKMTARAK Sbjct: 112 AFVAATAADRAAHKVSNDVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 161 >ref|XP_004234986.1| PREDICTED: acyl-CoA-binding domain-containing protein 1 [Solanum lycopersicum] Length = 346 Score = 45.1 bits (105), Expect(4) = 2e-09 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 154 QAWQKLGAMPPEEAMEKYLDIVTEL 178 Score = 32.7 bits (73), Expect(4) = 2e-09 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNEG 254 D NLR+TR+ +EAE + +E +S E+ EPL+ N+G Sbjct: 33 DENLRITRADSSEAEEKTSPEEAGVS----EDTEPLIQRNDG 70 Score = 27.3 bits (59), Expect(4) = 2e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQYL ++ FG+ Sbjct: 1 MADWQQYLQSIIFGL 15 Score = 22.7 bits (47), Expect(4) = 2e-09 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 104 AFVVATAADRSHKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 152 >ref|XP_006350518.1| PREDICTED: acyl-CoA-binding domain-containing protein 1 [Solanum tuberosum] Length = 348 Score = 45.1 bits (105), Expect(4) = 3e-09 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 157 QAWQKLGAMPPEEAMEKYLDIVTEL 181 Score = 32.0 bits (71), Expect(4) = 3e-09 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNEG 254 D NLR+TR+ +EAE + +E + + E+ EPL+ N+G Sbjct: 33 DENLRITRADSSEAEEKRSPEEADI-IGVSEDTEPLIQRNDG 73 Score = 27.3 bits (59), Expect(4) = 3e-09 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQYL ++ FG+ Sbjct: 1 MADWQQYLQSIIFGL 15 Score = 22.7 bits (47), Expect(4) = 3e-09 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 107 AFVAATAADRSHKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 155 >ref|XP_011084528.1| acyl-CoA-binding domain-containing protein 1-like [Sesamum indicum] ref|XP_011084529.1| acyl-CoA-binding domain-containing protein 1-like [Sesamum indicum] ref|XP_020550858.1| acyl-CoA-binding domain-containing protein 1-like [Sesamum indicum] Length = 356 Score = 57.0 bits (136), Expect(2) = 1e-08 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = +3 Query: 135 NLRVTRSHQTEAE--SEPEFDEKSLSSS--ILEENEPLVGVNEGLTNDEA 272 NLR+TRSHQTEAE S+ +FDEK SSS +LEENEPL+G NEG A Sbjct: 35 NLRITRSHQTEAEDDSKRQFDEKIASSSGRVLEENEPLLGDNEGAVKKSA 84 Score = 29.6 bits (65), Expect(2) = 1e-08 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M +WQQYL +VFFGV Sbjct: 1 MAEWQQYLQSVFFGV 15 >ref|XP_015067401.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Solanum pennellii] ref|XP_015067402.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Solanum pennellii] Length = 348 Score = 45.1 bits (105), Expect(4) = 4e-08 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 157 QAWQKLGAMPPEEAMEKYLDIVTEL 181 Score = 30.0 bits (66), Expect(4) = 4e-08 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNE 251 D NLR+TR+ +EAE E E++ + + E+ EPL+ N+ Sbjct: 33 DENLRITRADSSEAE-EKTSPEEADTIGVSEDTEPLIQRND 72 Score = 25.4 bits (54), Expect(4) = 4e-08 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQ+L ++ FG+ Sbjct: 1 MADWQQHLQSIIFGL 15 Score = 22.7 bits (47), Expect(4) = 4e-08 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 107 AFVAATAADRSHKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 155 >ref|XP_016446270.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Nicotiana tabacum] Length = 402 Score = 45.1 bits (105), Expect(4) = 1e-07 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 211 QAWQKLGAMPPEEAMEKYLDIVTEL 235 Score = 30.4 bits (67), Expect(4) = 1e-07 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 26 VVMGDWQQYLPTVFFGV 76 ++M DWQQYL +V FGV Sbjct: 59 ILMADWQQYLQSVIFGV 75 Score = 23.1 bits (48), Expect(4) = 1e-07 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNEGLTN 263 D NLR+TR E E + ++ + EPL+ N+G N Sbjct: 93 DENLRITRGDSYEVEPNIQSEDTT--------TEPLIQRNDGGLN 129 Score = 22.7 bits (47), Expect(4) = 1e-07 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 161 AFVAATAADRSHKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 209 >ref|XP_009773322.1| PREDICTED: acyl-CoA-binding domain-containing protein 1-like [Nicotiana sylvestris] Length = 402 Score = 45.1 bits (105), Expect(4) = 1e-07 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 211 QAWQKLGAMPPEEAMEKYLDIVTEL 235 Score = 30.4 bits (67), Expect(4) = 1e-07 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 26 VVMGDWQQYLPTVFFGV 76 ++M DWQQYL +V FGV Sbjct: 59 ILMADWQQYLQSVIFGV 75 Score = 23.1 bits (48), Expect(4) = 1e-07 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNEGLTN 263 D NLR+TR E E + ++ + EPL+ N+G N Sbjct: 93 DENLRITRGDSYEVEPNIQSEDTT--------TEPLIQRNDGGLN 129 Score = 22.7 bits (47), Expect(4) = 1e-07 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 161 AFVAATAADRSHKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 209 >ref|XP_019200430.1| PREDICTED: acyl-CoA-binding domain-containing protein 1 [Ipomoea nil] Length = 351 Score = 45.8 bits (107), Expect(4) = 1e-07 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ YID+VTEL Sbjct: 163 QAWQKLGAMPPEEAMEKYIDIVTEL 187 Score = 28.5 bits (62), Expect(4) = 1e-07 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEF-------DEKSLSSSILEENEPLVG 242 D NLR++RS + +S+ D L +LEE EPL+G Sbjct: 33 DENLRISRSDSVDEDSKAVDAPLKTGNDADLLGDEVLEEKEPLIG 77 Score = 24.6 bits (52), Expect(4) = 1e-07 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQ++ +V FG+ Sbjct: 1 MADWQQFVQSVVFGL 15 Score = 22.3 bits (46), Expect(4) = 1e-07 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 27/50 (54%) Frame = +2 Query: 320 AFVTATAAP----KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 112 AFVAATAADRSALKVSNELQLQLYGFYKIATEGPCSAPQPSALKMTARAK 161 >ref|XP_019237641.1| PREDICTED: acyl-CoA-binding domain-containing protein 1 [Nicotiana attenuata] gb|OIT22271.1| acyl-coa-binding domain-containing protein 1 [Nicotiana attenuata] Length = 342 Score = 45.1 bits (105), Expect(4) = 3e-07 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 399 QAWRKLGSMSPEEAMQNYIDVVTEL 473 QAW+KLG+M PEEAM+ Y+D+VTEL Sbjct: 151 QAWQKLGAMPPEEAMEKYLDIVTEL 175 Score = 28.9 bits (63), Expect(4) = 3e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 32 MGDWQQYLPTVFFGV 76 M DWQQYL +V FGV Sbjct: 1 MADWQQYLQSVIFGV 15 Score = 23.5 bits (49), Expect(4) = 3e-07 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 129 DLNLRVTRSHQTEAESEPEFDEKSLSSSILEENEPLVGVNEGLTN 263 D NLR+TR E E + ++ + EPL+ N+G N Sbjct: 33 DENLRITRGDSYEVEPNIQSEDTT--------TEPLIQSNDGGLN 69 Score = 22.7 bits (47), Expect(4) = 3e-07 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 26/49 (53%) Frame = +2 Query: 320 AFVTATAAP---KVSNE-----------------------ALKMTARAK 388 AFV ATAA KVSNE ALKMTARAK Sbjct: 101 AFVAATAADRSQKVSNEVQLQLYGLYKIATEGPCTAPQPSALKMTARAK 149