BLASTX nr result
ID: Rehmannia32_contig00000944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00000944 (1211 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV21515.1| photosystem I reaction center subunit IV A, chlor... 71 3e-11 ref|XP_011080143.1| photosystem I reaction center subunit IV B, ... 70 1e-10 ref|XP_011083089.1| photosystem I reaction center subunit IV A, ... 69 1e-10 gb|EPS72223.1| hypothetical protein M569_02531 [Genlisea aurea] 68 3e-10 gb|PIN17726.1| hypothetical protein CDL12_09607 [Handroanthus im... 68 4e-10 gb|KHL91113.1| Photosystem I reaction center subunit IV [Paeniba... 65 5e-10 gb|PIM97301.1| hypothetical protein CDL12_30229 [Handroanthus im... 68 5e-10 gb|PHU16304.1| Photosystem I reaction center subunit IV, chlorop... 65 9e-10 ref|XP_012830515.1| PREDICTED: photosystem I reaction center sub... 67 9e-10 emb|CAK18840.1| subunit IV of photosystem I (PSI-E) precursor, p... 64 9e-10 dbj|BAA84770.1| photosystem I subunit PSI-E, partial [Arabidopsi... 64 9e-10 ref|WP_083442887.1| hypothetical protein [Paenibacillus sp. IHB ... 65 1e-09 ref|XP_021992807.1| photosystem I reaction center subunit IV A, ... 67 1e-09 gb|KVI07855.1| Electron transport accessory protein-like domain-... 67 1e-09 gb|AEC11063.1| photosystem I reaction center subunit iv b, parti... 65 1e-09 ref|XP_016167229.1| photosystem I reaction center subunit IV B, ... 67 1e-09 ref|XP_016183198.1| photosystem I reaction center subunit IV, ch... 67 1e-09 ref|XP_015931371.1| photosystem I reaction center subunit IV B, ... 67 1e-09 gb|PHT80404.1| Photosystem I reaction center subunit IV, chlorop... 65 1e-09 pdb|2O01|E Chain E, The Structure Of A Plant Photosystem I Super... 64 2e-09 >gb|KZV21515.1| photosystem I reaction center subunit IV A, chloroplastic [Dorcoceras hygrometricum] Length = 127 Score = 70.9 bits (172), Expect = 3e-11 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 4/54 (7%) Frame = +3 Query: 156 PANPDPRTRTQPILTPL----PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 P P ++ P+ P PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV+ Sbjct: 74 PGEPKADSKPAPVGPPRGSKDPKTRYPVVVRFNKVNYANVSTNNYALDEVEVVS 127 >ref|XP_011080143.1| photosystem I reaction center subunit IV B, chloroplastic [Sesamum indicum] Length = 140 Score = 69.7 bits (169), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA Sbjct: 108 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 140 >ref|XP_011083089.1| photosystem I reaction center subunit IV A, chloroplastic [Sesamum indicum] Length = 139 Score = 69.3 bits (168), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDEVEV+A Sbjct: 107 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVIA 139 >gb|EPS72223.1| hypothetical protein M569_02531 [Genlisea aurea] Length = 135 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDEVE VA Sbjct: 103 PKTRYPVVVRFNKVNYANVSTNNYALDEVEAVA 135 >gb|PIN17726.1| hypothetical protein CDL12_09607 [Handroanthus impetiginosus] Length = 141 Score = 68.2 bits (165), Expect = 4e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDEVE VA Sbjct: 109 PKTRYPVVVRFNKVNYANVSTNNYALDEVEAVA 141 >gb|KHL91113.1| Photosystem I reaction center subunit IV [Paenibacillus sp. IHB B 3415] Length = 64 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE+E V Sbjct: 32 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEV 63 >gb|PIM97301.1| hypothetical protein CDL12_30229 [Handroanthus impetiginosus] Length = 152 Score = 68.2 bits (165), Expect = 5e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV Sbjct: 121 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 152 >gb|PHU16304.1| Photosystem I reaction center subunit IV, chloroplastic, partial [Capsicum chinense] Length = 87 Score = 65.5 bits (158), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE+E V Sbjct: 55 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEV 86 >ref|XP_012830515.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic [Erythranthe guttata] gb|EYU46372.1| hypothetical protein MIMGU_mgv1a015998mg [Erythranthe guttata] Length = 138 Score = 67.0 bits (162), Expect = 9e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDEVE+V Sbjct: 106 PKTRYPVVVRFNKVNYANVSTNNYALDEVELV 137 >emb|CAK18840.1| subunit IV of photosystem I (PSI-E) precursor, partial [Phillyrea latifolia] Length = 51 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE++ V Sbjct: 19 PKTRYPVVVRFNKVNYANVSTNNYALDEIQEV 50 >dbj|BAA84770.1| photosystem I subunit PSI-E, partial [Arabidopsis thaliana] Length = 38 Score = 63.9 bits (154), Expect = 9e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRF KVNYAN+STNNYALDEVE VA Sbjct: 5 PKTRYPVVVRFAKVNYANISTNNYALDEVEEVA 37 >ref|WP_083442887.1| hypothetical protein [Paenibacillus sp. IHB B 3415] Length = 93 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE+E V Sbjct: 61 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEV 92 >ref|XP_021992807.1| photosystem I reaction center subunit IV A, chloroplastic-like [Helianthus annuus] gb|OTG07167.1| putative photosystem I reaction center subunit IV protein [Helianthus annuus] Length = 149 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDE+E VA Sbjct: 117 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEVA 149 >gb|KVI07855.1| Electron transport accessory protein-like domain-containing protein [Cynara cardunculus var. scolymus] Length = 149 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDE+E VA Sbjct: 117 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEVA 149 >gb|AEC11063.1| photosystem I reaction center subunit iv b, partial (chloroplast) [Camellia sinensis] Length = 99 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE+E V Sbjct: 54 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEV 85 >ref|XP_016167229.1| photosystem I reaction center subunit IV B, chloroplastic [Arachis ipaensis] Length = 151 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDE+E VA Sbjct: 119 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEVA 151 >ref|XP_016183198.1| photosystem I reaction center subunit IV, chloroplastic [Arachis ipaensis] Length = 151 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDE+E VA Sbjct: 119 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEVA 151 >ref|XP_015931371.1| photosystem I reaction center subunit IV B, chloroplastic [Arachis duranensis] Length = 151 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRFNKVNYANVSTNNYALDE+E VA Sbjct: 119 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEVA 151 >gb|PHT80404.1| Photosystem I reaction center subunit IV, chloroplastic [Capsicum annuum] Length = 106 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVV 302 PKTRYPVVVRFNKVNYANVSTNNYALDE+E V Sbjct: 74 PKTRYPVVVRFNKVNYANVSTNNYALDEIEEV 105 >pdb|2O01|E Chain E, The Structure Of A Plant Photosystem I Supercomplex At 3.4 Angstrom Resolution Length = 62 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 207 PKTRYPVVVRFNKVNYANVSTNNYALDEVEVVA 305 PKTRYPVVVRF KVNYAN+STNNYALDEVE VA Sbjct: 30 PKTRYPVVVRFAKVNYANISTNNYALDEVEEVA 62