BLASTX nr result
ID: Rehmannia32_contig00000800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00000800 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073125.1| uncharacterized protein LOC105158173 [Sesamu... 100 1e-20 gb|PIN07886.1| Armadillo repeat protein VAC8 [Handroanthus impet... 89 7e-17 ref|XP_012842729.1| PREDICTED: uncharacterized protein LOC105962... 83 5e-15 gb|KZV46483.1| hypothetical protein F511_10588 [Dorcoceras hygro... 69 3e-10 ref|XP_022872195.1| uncharacterized protein LOC111391256 [Olea e... 67 3e-09 gb|AAX19931.1| viral replicase [Nandina mosaic virus] 65 1e-08 dbj|BAX03478.1| RNA-dependent RNA polymerase [Plantago asiatica ... 65 1e-08 gb|PIM98721.1| hypothetical protein CDL12_28795 [Handroanthus im... 64 2e-08 ref|NP_620836.1| replicase [Plantago asiatica mosaic virus] >gi|... 63 7e-08 dbj|BAX03473.1| RNA-dependent RNA polymerase [Plantago asiatica ... 63 7e-08 gb|AMN10083.1| RNA-dependent RNA polymerase [Plantago asiatica m... 63 7e-08 gb|AVL84357.1| RNA-dependent RNA polymerase [Plantago asiatica m... 63 7e-08 gb|AGW45389.1| RNA-dependent RNA polymerase, partial [Plantago a... 61 3e-07 dbj|BAG12153.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12148.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12143.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12138.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12133.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12128.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 dbj|BAG12123.1| RNA-dependent RNA polymerase [Plantago asiatica ... 61 3e-07 >ref|XP_011073125.1| uncharacterized protein LOC105158173 [Sesamum indicum] Length = 588 Score = 99.8 bits (247), Expect = 1e-20 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 1/75 (1%) Frame = -2 Query: 227 TQNLFSAPPNHPKPP-AMKEAADEEPINPLLTDIQELIHSLLQSTSHVQILKCKWSLVNT 51 ++NLFS+ P P P AMKEAADEEPINPLLTDI + SL QST+HVQILK KWSL+ T Sbjct: 11 SRNLFSSVPPTPFPSKAMKEAADEEPINPLLTDIHHQLQSLSQSTTHVQILKGKWSLITT 70 Query: 50 KLTTLETRLSDLSLP 6 KL TL+ RLSDLS+P Sbjct: 71 KLITLQNRLSDLSIP 85 >gb|PIN07886.1| Armadillo repeat protein VAC8 [Handroanthus impetiginosus] Length = 560 Score = 88.6 bits (218), Expect = 7e-17 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = -2 Query: 179 MKEAADEEPINPLLTDIQELIHSLLQSTSHVQILKCKWSLVNTKLTTLETRLSDLSLP 6 MKEA DEEPINP++T+IQ+L+ L++ST HVQILK KWSL+ TKLTTL++RLSDLS+P Sbjct: 1 MKEATDEEPINPIVTNIQQLLDLLIESTYHVQILKGKWSLITTKLTTLQSRLSDLSIP 58 >ref|XP_012842729.1| PREDICTED: uncharacterized protein LOC105962929 [Erythranthe guttata] gb|EYU32919.1| hypothetical protein MIMGU_mgv1a003778mg [Erythranthe guttata] Length = 564 Score = 83.2 bits (204), Expect = 5e-15 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = -2 Query: 179 MKEAADEEPIN-PLLTDIQELIHSLLQSTSHVQILKCKWSLVNTKLTTLETRLSDLSLPT 3 MKEA++ EPIN P LTD Q+L+HSL++STS VQILK KWS + TKLT L TRLSDLS+PT Sbjct: 1 MKEASEGEPINNPALTDTQQLLHSLVESTSQVQILKSKWSPITTKLTALATRLSDLSIPT 60 >gb|KZV46483.1| hypothetical protein F511_10588 [Dorcoceras hygrometricum] Length = 566 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = -2 Query: 179 MKEAADEEPINPLLTDIQELIHSLLQSTSHVQILKCKWSLVNTKLTTLETRLSDLSL 9 MKE+ EEP+ P+ TD + L+ SLL S SHVQI K KW+ + KL TLETRLS++S+ Sbjct: 1 MKESPQEEPVAPIFTDTEALLRSLLLSVSHVQIFKGKWTSIKVKLATLETRLSEISV 57 >ref|XP_022872195.1| uncharacterized protein LOC111391256 [Olea europaea var. sylvestris] Length = 563 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/56 (64%), Positives = 39/56 (69%) Frame = -2 Query: 179 MKEAADEEPINPLLTDIQELIHSLLQSTSHVQILKCKWSLVNTKLTTLETRLSDLS 12 MKEA EEPINP + +IQ LI SLL S S VQI K KWSL+ TKLT LET L S Sbjct: 1 MKEAVAEEPINPTVKNIQILIVSLLDSISRVQIFKGKWSLIRTKLTALETHLLKFS 56 >gb|AAX19931.1| viral replicase [Nandina mosaic virus] Length = 1368 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 32 >dbj|BAX03478.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1387 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 32 >gb|PIM98721.1| hypothetical protein CDL12_28795 [Handroanthus impetiginosus] Length = 564 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/59 (59%), Positives = 46/59 (77%), Gaps = 2/59 (3%) Frame = -2 Query: 179 MKEA-ADEEPINPL-LTDIQELIHSLLQSTSHVQILKCKWSLVNTKLTTLETRLSDLSL 9 MKEA A+E+ P+ +T+I E + SLL+S SHVQI K KWSL+ TKL TL+TRLSD+S+ Sbjct: 1 MKEATAEEDHFKPITVTNIHESLKSLLESISHVQIFKGKWSLIATKLATLQTRLSDVSI 59 >ref|NP_620836.1| replicase [Plantago asiatica mosaic virus] sp|Q07518.1|RDRP_P1AMV RecName: Full=RNA replication protein; AltName: Full=156 kDa protein; AltName: Full=ORF1 protein; Includes: RecName: Full=RNA-directed RNA polymerase; Includes: RecName: Full=Helicase emb|CAA79761.1| 156K-protein [Plantago asiatica mosaic virus] Length = 1385 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRVLKREL 32 >dbj|BAX03473.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1387 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYRTLK EL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKHEL 32 >gb|AMN10083.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1387 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRVLKREL 32 >gb|AVL84357.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1388 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVFSQLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFSQLTDPSLKAVIQDEAYRVLKREL 32 >gb|AGW45389.1| RNA-dependent RNA polymerase, partial [Plantago asiatica mosaic virus] Length = 669 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12153.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12148.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12143.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12138.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12133.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12128.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32 >dbj|BAG12123.1| RNA-dependent RNA polymerase [Plantago asiatica mosaic virus] Length = 1380 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 517 MSNVRNVFSQLTDPSLKAVIQDEAYRTLKREL 612 MSNVRNVF+QLTDPSLKAVIQDEAYR LKREL Sbjct: 1 MSNVRNVFAQLTDPSLKAVIQDEAYRHLKREL 32