BLASTX nr result
ID: Rehmannia32_contig00000619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00000619 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22882.1| hypothetical protein CDL12_04399 [Handroanthus im... 62 4e-10 >gb|PIN22882.1| hypothetical protein CDL12_04399 [Handroanthus impetiginosus] Length = 81 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 125 TFACGFDVAYRWFSFSDYLSLDGNFCVCLLVGTYS 21 + ACGFDVAYRWF+FSDYLSLDGN VCL + TYS Sbjct: 19 SLACGFDVAYRWFNFSDYLSLDGNLRVCLPLWTYS 53