BLASTX nr result
ID: Rehmannia31_contig00031250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00031250 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077891.1| BTB/POZ domain-containing protein FBL11 isof... 61 1e-07 ref|XP_011077890.1| BTB/POZ domain-containing protein FBL11 isof... 61 1e-07 ref|XP_020549702.1| BTB/POZ domain-containing protein FBL11 isof... 61 1e-07 ref|XP_020549701.1| BTB/POZ domain-containing protein FBL11 isof... 61 1e-07 gb|EYU38623.1| hypothetical protein MIMGU_mgv1a0009752mg, partia... 61 2e-07 ref|XP_012835815.1| PREDICTED: BTB/POZ domain-containing protein... 61 2e-07 gb|PIN16821.1| hypothetical protein CDL12_10523 [Handroanthus im... 57 2e-06 >ref|XP_011077891.1| BTB/POZ domain-containing protein FBL11 isoform X4 [Sesamum indicum] Length = 814 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 665 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGEI 697 >ref|XP_011077890.1| BTB/POZ domain-containing protein FBL11 isoform X3 [Sesamum indicum] Length = 913 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 764 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGEI 796 >ref|XP_020549702.1| BTB/POZ domain-containing protein FBL11 isoform X2 [Sesamum indicum] Length = 959 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 810 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGEI 842 >ref|XP_020549701.1| BTB/POZ domain-containing protein FBL11 isoform X1 [Sesamum indicum] Length = 967 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 818 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGEI 850 >gb|EYU38623.1| hypothetical protein MIMGU_mgv1a0009752mg, partial [Erythranthe guttata] Length = 895 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 746 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGKI 778 >ref|XP_012835815.1| PREDICTED: BTB/POZ domain-containing protein FBL11 [Erythranthe guttata] Length = 970 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGCTLLDSEAQ IISSGWPGLTSLHLE C + Sbjct: 821 LIGCTLLDSEAQAIISSGWPGLTSLHLEECGKI 853 >gb|PIN16821.1| hypothetical protein CDL12_10523 [Handroanthus impetiginosus] Length = 785 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 2 LIGCTLLDSEAQDIISSGWPGLTSLHLEVCSHL 100 LIGC LDSEAQ IISSGWPGLTSLHLE C + Sbjct: 636 LIGCKFLDSEAQAIISSGWPGLTSLHLEECGEI 668