BLASTX nr result
ID: Rehmannia31_contig00031133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00031133 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086288.1| BTB/POZ domain-containing protein At5g47800 ... 80 4e-14 ref|XP_011086287.1| BTB/POZ domain-containing protein At5g47800 ... 80 4e-14 gb|PIM99668.1| hypothetical protein CDL12_27831 [Handroanthus im... 74 3e-12 ref|XP_012848837.1| PREDICTED: BTB/POZ domain-containing protein... 73 1e-11 ref|XP_012848835.1| PREDICTED: BTB/POZ domain-containing protein... 73 1e-11 ref|XP_024021483.1| BTB/POZ domain-containing protein At5g47800 ... 72 2e-11 gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis] 72 2e-11 gb|PON90325.1| SKP1/BTB/POZ domain containing protein [Trema ori... 72 3e-11 ref|XP_021293669.1| BTB/POZ domain-containing protein At5g47800 ... 71 4e-11 ref|XP_021293668.1| BTB/POZ domain-containing protein At5g47800 ... 71 4e-11 ref|XP_021293667.1| BTB/POZ domain-containing protein At5g47800 ... 71 4e-11 ref|XP_017979004.1| PREDICTED: BTB/POZ domain-containing protein... 71 4e-11 ref|XP_017979003.1| PREDICTED: BTB/POZ domain-containing protein... 71 4e-11 ref|XP_021293666.1| BTB/POZ domain-containing protein At5g47800 ... 71 4e-11 ref|XP_017979002.1| PREDICTED: BTB/POZ domain-containing protein... 71 4e-11 ref|XP_017979001.1| PREDICTED: BTB/POZ domain-containing protein... 71 4e-11 emb|CDP04549.1| unnamed protein product [Coffea canephora] 71 4e-11 ref|XP_023759609.1| BTB/POZ domain-containing protein At5g47800 ... 70 7e-11 ref|XP_023759024.1| BTB/POZ domain-containing protein At5g47800 ... 70 7e-11 ref|XP_012074827.1| BTB/POZ domain-containing protein At5g47800 ... 70 7e-11 >ref|XP_011086288.1| BTB/POZ domain-containing protein At5g47800 isoform X2 [Sesamum indicum] Length = 671 Score = 79.7 bits (195), Expect = 4e-14 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = -1 Query: 191 GKGESEFYELRPRNFLTNA*LSRKMKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINN 12 G+G+ E Y+L P +F+ ++ MKFMKLG DTFYTEEA RTV+SDVPSDLTIRINN Sbjct: 50 GEGKPELYQLWPESFVPKGFIA-DMKFMKLGAGPDTFYTEEATRTVLSDVPSDLTIRINN 108 Query: 11 ISY 3 I+Y Sbjct: 109 ITY 111 >ref|XP_011086287.1| BTB/POZ domain-containing protein At5g47800 isoform X1 [Sesamum indicum] Length = 673 Score = 79.7 bits (195), Expect = 4e-14 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = -1 Query: 191 GKGESEFYELRPRNFLTNA*LSRKMKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINN 12 G+G+ E Y+L P +F+ ++ MKFMKLG DTFYTEEA RTV+SDVPSDLTIRINN Sbjct: 50 GEGKPELYQLWPESFVPKGFIA-DMKFMKLGAGPDTFYTEEATRTVLSDVPSDLTIRINN 108 Query: 11 ISY 3 I+Y Sbjct: 109 ITY 111 >gb|PIM99668.1| hypothetical protein CDL12_27831 [Handroanthus impetiginosus] Length = 541 Score = 74.3 bits (181), Expect = 3e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMKLGTR DTFYTEEA RTVISDVPSD+TIRINNI+Y Sbjct: 1 MKFMKLGTRADTFYTEEATRTVISDVPSDITIRINNITY 39 >ref|XP_012848837.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Erythranthe guttata] gb|EYU27638.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata] gb|EYU27639.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata] Length = 569 Score = 72.8 bits (177), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMKLGTR DTFYTEEA RTVISDVPSD+TIRINN++Y Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVISDVPSDVTIRINNVTY 39 >ref|XP_012848835.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Erythranthe guttata] ref|XP_012848836.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Erythranthe guttata] Length = 571 Score = 72.8 bits (177), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMKLGTR DTFYTEEA RTVISDVPSD+TIRINN++Y Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVISDVPSDVTIRINNVTY 39 >ref|XP_024021483.1| BTB/POZ domain-containing protein At5g47800 isoform X1 [Morus notabilis] Length = 602 Score = 72.0 bits (175), Expect = 2e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GTR DTFYTEEAVRT+ISDVPSDL+I+INNISY Sbjct: 1 MKFMKIGTRPDTFYTEEAVRTLISDVPSDLSIQINNISY 39 >gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 794 Score = 72.0 bits (175), Expect = 2e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GTR DTFYTEEAVRT+ISDVPSDL+I+INNISY Sbjct: 1 MKFMKIGTRPDTFYTEEAVRTLISDVPSDLSIQINNISY 39 >gb|PON90325.1| SKP1/BTB/POZ domain containing protein [Trema orientalis] Length = 593 Score = 71.6 bits (174), Expect = 3e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GTR DTFYTEEAVRT+ISD+PSDL+I+INNISY Sbjct: 1 MKFMKIGTRPDTFYTEEAVRTLISDIPSDLSIQINNISY 39 >ref|XP_021293669.1| BTB/POZ domain-containing protein At5g47800 isoform X5 [Herrania umbratica] Length = 520 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_021293668.1| BTB/POZ domain-containing protein At5g47800 isoform X4 [Herrania umbratica] Length = 522 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_021293667.1| BTB/POZ domain-containing protein At5g47800 isoform X3 [Herrania umbratica] Length = 579 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_017979004.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X5 [Theobroma cacao] gb|EOY29029.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] gb|EOY29032.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] Length = 579 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_017979003.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X4 [Theobroma cacao] Length = 580 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_021293666.1| BTB/POZ domain-containing protein At5g47800 isoform X2 [Herrania umbratica] Length = 581 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_017979002.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X3 [Theobroma cacao] gb|EOY29030.1| Root phototropism protein, putative isoform 2 [Theobroma cacao] Length = 581 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >ref|XP_017979001.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Theobroma cacao] Length = 582 Score = 71.2 bits (173), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMK+GT+ DTFYTEEA RTVISD+PSDLTIRINNI Y Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICY 39 >emb|CDP04549.1| unnamed protein product [Coffea canephora] Length = 588 Score = 71.2 bits (173), Expect = 4e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMKLGTR DTFYTEEA RTVIS VP+DLT+RINNISY Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVISGVPTDLTVRINNISY 39 >ref|XP_023759609.1| BTB/POZ domain-containing protein At5g47800 isoform X2 [Lactuca sativa] gb|PLY99907.1| hypothetical protein LSAT_7X12801 [Lactuca sativa] Length = 573 Score = 70.5 bits (171), Expect = 7e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFM+LGTR D FYTEEA+RTV+SD+PSDLTIR+NNI+Y Sbjct: 1 MKFMRLGTRPDNFYTEEAIRTVVSDLPSDLTIRVNNITY 39 >ref|XP_023759024.1| BTB/POZ domain-containing protein At5g47800 isoform X1 [Lactuca sativa] Length = 575 Score = 70.5 bits (171), Expect = 7e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFM+LGTR D FYTEEA+RTV+SD+PSDLTIR+NNI+Y Sbjct: 1 MKFMRLGTRPDNFYTEEAIRTVVSDLPSDLTIRVNNITY 39 >ref|XP_012074827.1| BTB/POZ domain-containing protein At5g47800 isoform X2 [Jatropha curcas] Length = 590 Score = 70.5 bits (171), Expect = 7e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 119 MKFMKLGTRLDTFYTEEAVRTVISDVPSDLTIRINNISY 3 MKFMKLGTR DTFYTEEA R VISD+PSDL IR+NNISY Sbjct: 1 MKFMKLGTRPDTFYTEEATRCVISDIPSDLVIRVNNISY 39