BLASTX nr result
ID: Rehmannia31_contig00030340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00030340 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX64326.1| hypothetical protein L195_g053957, partial [Trifo... 79 2e-15 gb|PNX92571.1| histone deacetylase [Trifolium pratense] 82 2e-15 emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] 81 3e-15 gb|POO00746.1| hypothetical protein TorRG33x02_033770, partial [... 75 6e-15 emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] 79 2e-14 gb|PNY10806.1| histone deacetylase [Trifolium pratense] 79 3e-14 gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposo... 76 2e-13 dbj|GAU34785.1| hypothetical protein TSUD_205890 [Trifolium subt... 76 2e-13 gb|PNY02744.1| retrovirus-related Pol polyprotein from transposo... 76 2e-13 ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177... 75 3e-13 gb|PNY08092.1| histone deacetylase [Trifolium pratense] 75 3e-13 dbj|GAU32278.1| hypothetical protein TSUD_62940 [Trifolium subte... 75 3e-13 gb|KYP38387.1| Retrovirus-related Pol polyprotein from transposo... 75 5e-13 gb|KYP64199.1| Retrovirus-related Pol polyprotein from transposo... 75 6e-13 dbj|GAU28846.1| hypothetical protein TSUD_21830 [Trifolium subte... 75 6e-13 gb|PNX91972.1| retrovirus-related Pol polyprotein from transposo... 75 6e-13 gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposo... 74 1e-12 gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposo... 74 1e-12 gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposo... 74 1e-12 gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposo... 74 1e-12 >gb|PNX64326.1| hypothetical protein L195_g053957, partial [Trifolium pratense] Length = 193 Score = 78.6 bits (192), Expect = 2e-15 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 + S +CVFLGYSP HKGY+CL+ GRIY++R V FNEL FPYP++F SD S S Sbjct: 10 YHSKECVFLGYSPNHKGYKCLASDGRIYISRDVLFNELRFPYPSIFLTSDPKSDSS 65 >gb|PNX92571.1| histone deacetylase [Trifolium pratense] Length = 1488 Score = 81.6 bits (200), Expect = 2e-15 Identities = 38/58 (65%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVS--DSFSTPS 169 FRS +C+FLGYSP+HKGYRCLSPSGR+YV++ V FNE FPY LF +S S S PS Sbjct: 809 FRSQECLFLGYSPSHKGYRCLSPSGRLYVSKDVLFNESRFPYKELFPISSGSSHSPPS 866 >emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] Length = 1099 Score = 81.3 bits (199), Expect = 3e-15 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 8/65 (12%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLF--------SVSDSF 157 FRSTKC+FLGYSP HKGYRCLS SG+IYVA++++FNE +FPY TL S F Sbjct: 491 FRSTKCLFLGYSPXHKGYRCLSXSGQIYVAKSITFNENDFPYSTLLTQPNIPHQSFIHKF 550 Query: 158 STPSH 172 S PS+ Sbjct: 551 SCPSY 555 >gb|POO00746.1| hypothetical protein TorRG33x02_033770, partial [Trema orientalis] Length = 119 Score = 75.5 bits (184), Expect = 6e-15 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLF 139 FRS+KC+FLGYS AHKGY CL P+GR+Y++ V FNEL+FPY LF Sbjct: 9 FRSSKCLFLGYSSAHKGYMCLHPTGRVYISHNVVFNELDFPYSELF 54 >emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] Length = 722 Score = 79.0 bits (193), Expect = 2e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFS 142 F+STKC+FLGYSPAH GYRC S S RIYVA+ V+FNE +FPY TLF+ Sbjct: 517 FKSTKCLFLGYSPAHNGYRCFSSSNRIYVAKLVTFNENDFPYSTLFT 563 >gb|PNY10806.1| histone deacetylase [Trifolium pratense] Length = 1441 Score = 78.6 bits (192), Expect = 3e-14 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPSH 172 FRSTKCV+LG SP HKGY+CLSP GR+Y+++ V FNELEFPY LF + S S P++ Sbjct: 760 FRSTKCVYLGPSPHHKGYKCLSPDGRVYISKDVVFNELEFPYSILFP-NTSRSAPTN 815 >gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 839 Score = 76.3 bits (186), Expect = 2e-13 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 FRS +CVFLGYS +HKGY+CL+PSGR+++++ V F E FPYPTLFS STPS Sbjct: 394 FRSQECVFLGYSTSHKGYKCLAPSGRVFISKDVIFCENRFPYPTLFSP----STPS 445 >dbj|GAU34785.1| hypothetical protein TSUD_205890 [Trifolium subterraneum] Length = 888 Score = 76.3 bits (186), Expect = 2e-13 Identities = 35/56 (62%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLF-SVSDSFSTP 166 FRS +C+FLGYS HKGY+CLSP+GRIYV++ V FNE FPY LF + + S STP Sbjct: 612 FRSHECIFLGYSTTHKGYKCLSPTGRIYVSKDVIFNEQRFPYKILFPTQTSSLSTP 667 >gb|PNY02744.1| retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Trifolium pratense] Length = 489 Score = 75.9 bits (185), Expect = 2e-13 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTP 166 FRS +C+FLG S HKGY+CLSPSGRI++++ V FNE FPY +LFS+S+ +P Sbjct: 308 FRSHECIFLGNSTTHKGYKCLSPSGRIFISKDVLFNESRFPYESLFSISNKALSP 362 >ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177515 [Citrus sinensis] Length = 1143 Score = 75.5 bits (184), Expect = 3e-13 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDS 154 F ++KCVFLGYSP HKGY+CL PSGR Y+A V F+E FPY +LF VS S Sbjct: 782 FHTSKCVFLGYSPLHKGYKCLHPSGRTYIASHVLFDESSFPYSSLFHVSSS 832 >gb|PNY08092.1| histone deacetylase [Trifolium pratense] Length = 1339 Score = 75.5 bits (184), Expect = 3e-13 Identities = 33/53 (62%), Positives = 43/53 (81%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFS 160 FRS +C+FLGYS HKGY+CLSP+GRI+V++ V FNE FPYP+LF S++ S Sbjct: 668 FRSHECIFLGYSNTHKGYKCLSPTGRIFVSKDVLFNEDRFPYPSLFPNSNNNS 720 >dbj|GAU32278.1| hypothetical protein TSUD_62940 [Trifolium subterraneum] Length = 1409 Score = 75.5 bits (184), Expect = 3e-13 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDS 154 FRS +C+FLGYS HKGY+CLSP+GRIYV++ V FNE FPY +LF +S Sbjct: 762 FRSHECIFLGYSTTHKGYKCLSPTGRIYVSKDVMFNESRFPYESLFPTPNS 812 >gb|KYP38387.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 600 Score = 74.7 bits (182), Expect = 5e-13 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = +2 Query: 5 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 RS +C+FLGYSP HKGY+CLS SGRIY+++ V FNE FPY LF STP+ Sbjct: 375 RSEECLFLGYSPTHKGYKCLSKSGRIYISKDVVFNESRFPYQDLFVSKSVSSTPA 429 >gb|KYP64199.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1408 Score = 74.7 bits (182), Expect = 6e-13 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +2 Query: 5 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 RS +CVFLGYSP HKGY+CLS SGRIY+++ V FNE FPY LF + S S P+ Sbjct: 746 RSEECVFLGYSPLHKGYKCLSKSGRIYISKDVIFNEGRFPYHDLFVTATSDSIPA 800 >dbj|GAU28846.1| hypothetical protein TSUD_21830 [Trifolium subterraneum] Length = 1496 Score = 74.7 bits (182), Expect = 6e-13 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTP 166 +RS +C+FLGYS +KGY+CLSP G +YV++ V FNE +FPYP LFS + + +P Sbjct: 795 YRSKECIFLGYSAMYKGYKCLSPDGHVYVSKDVLFNEHKFPYPLLFSTTSTSKSP 849 >gb|PNX91972.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trifolium pratense] Length = 1516 Score = 74.7 bits (182), Expect = 6e-13 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 5 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDS 154 RS +C+FLGYS HKGY+CLSP+GRI+V++ V FNE FPY +LFS DS Sbjct: 837 RSHECIFLGYSNTHKGYKCLSPTGRIFVSKDVLFNEHRFPYKSLFSTQDS 886 >gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 488 Score = 73.9 bits (180), Expect = 1e-12 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +2 Query: 5 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 RS +CVFLGYSP+HKGY+CLS SGRIY+++ V FNE FPY LF + S P+ Sbjct: 244 RSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLFVTTTQASIPA 298 >gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 904 Score = 73.9 bits (180), Expect = 1e-12 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = +2 Query: 5 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 RS +CVFLGYSP+HKGY+CLS SGRIY+++ V FNE FPY LF + S P+ Sbjct: 713 RSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLFVTTTQASIPA 767 >gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 661 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 FRS +CVFLGYS +HKGY+CL+PSGRI++++ V F E FPYP++F S S+ S Sbjct: 359 FRSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMFPPSTPSSSSS 414 >gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 682 Score = 73.6 bits (179), Expect = 1e-12 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = +2 Query: 2 FRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVSFNELEFPYPTLFSVSDSFSTPS 169 FRS +CVFLGYS +HKGY+CL+PSGRI++++ V F E FPYP++F S S+ S Sbjct: 380 FRSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMFPPSTPSSSSS 435