BLASTX nr result
ID: Rehmannia31_contig00030335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00030335 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20304.1| hypothetical protein CDL12_06984 [Handroanthus im... 54 1e-06 >gb|PIN20304.1| hypothetical protein CDL12_06984 [Handroanthus impetiginosus] Length = 129 Score = 54.3 bits (129), Expect = 1e-06 Identities = 30/58 (51%), Positives = 33/58 (56%) Frame = -1 Query: 421 RRSWSEGCLALMNXXXXXXXXXXXXXXXXXXXAGQRDITRTQTQLVLCKEEDEEGDQV 248 RRSWSEGCLALMN +ITRTQT LVLCKEEDEE +Q+ Sbjct: 60 RRSWSEGCLALMNPSPNSGVVSPCSSSPTVAA-AHGEITRTQTHLVLCKEEDEEDEQL 116