BLASTX nr result
ID: Rehmannia31_contig00030332
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00030332 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093464.1| putative ABC transporter C family member 15 ... 59 3e-07 gb|PIN06814.1| Multidrug resistance-associated protein/mitoxantr... 58 4e-07 >ref|XP_011093464.1| putative ABC transporter C family member 15 isoform X1 [Sesamum indicum] Length = 1500 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -3 Query: 145 MALAQIYSSAASFGFLQIWIALPELISPCFWEDASIILQLGFLAILL 5 M L +++++ A+ FL+ +A PE ISPC WE+ASIILQLGFLA+L+ Sbjct: 1 MVLERMFTTPANLRFLEFRVAWPEQISPCLWENASIILQLGFLAVLM 47 >gb|PIN06814.1| Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Handroanthus impetiginosus] Length = 1500 Score = 58.2 bits (139), Expect = 4e-07 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -3 Query: 145 MALAQIYSSAASFGFLQIWIALPELISPCFWEDASIILQLGFLAILL 5 MAL +++ SA++F FL PELISPCFWEDASI+LQL FL ILL Sbjct: 1 MALEEMFRSASNFRFL------PELISPCFWEDASIVLQLVFLVILL 41