BLASTX nr result
ID: Rehmannia31_contig00030237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00030237 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34291.1| hypothetical protein MIMGU_mgv1a024425mg, partial... 61 4e-08 gb|EYU34292.1| hypothetical protein MIMGU_mgv1a023970mg [Erythra... 59 3e-07 >gb|EYU34291.1| hypothetical protein MIMGU_mgv1a024425mg, partial [Erythranthe guttata] Length = 309 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +2 Query: 323 NESIKLLPKNGKLMAFIAIFSVVLSSTVFLLFSY 424 NESIKLLPKNGKLMAFIA++S+ LSST+FLLF+Y Sbjct: 6 NESIKLLPKNGKLMAFIALYSLALSSTIFLLFNY 39 >gb|EYU34292.1| hypothetical protein MIMGU_mgv1a023970mg [Erythranthe guttata] Length = 336 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 323 NESIKLLPKNGKLMAFIAIFSVVLSSTVFLLFSY 424 NESIKL+P+NGKLMAF+AI S+ LSST+FLLFSY Sbjct: 18 NESIKLIPRNGKLMAFVAISSLALSSTIFLLFSY 51