BLASTX nr result
ID: Rehmannia31_contig00030014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00030014 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080923.2| BTB/POZ domain-containing protein At1g63850-... 97 4e-21 gb|KVH90128.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 97 8e-21 gb|POF08562.1| btb/poz domain-containing protein [Quercus suber] 96 2e-20 ref|XP_023914138.1| BTB/POZ domain-containing protein At1g63850 ... 96 2e-20 ref|XP_015085210.1| PREDICTED: BTB/POZ domain-containing protein... 95 3e-20 ref|XP_012834299.1| PREDICTED: BTB/POZ domain-containing protein... 95 4e-20 ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein... 94 7e-20 gb|PHT57694.1| BTB/POZ domain-containing protein [Capsicum bacca... 94 7e-20 gb|PHU28039.1| BTB/POZ domain-containing protein [Capsicum chine... 94 7e-20 ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein... 94 7e-20 ref|XP_022862861.1| BTB/POZ domain-containing protein At1g63850 ... 94 9e-20 gb|PON62924.1| BTB/POZ domain containing protein [Parasponia and... 94 9e-20 gb|PON84537.1| BTB/POZ domain containing protein [Trema orientalis] 94 9e-20 ref|XP_023738493.1| BTB/POZ domain-containing protein At1g63850-... 93 2e-19 ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein... 93 2e-19 ref|XP_011073126.1| LOW QUALITY PROTEIN: BTB/POZ domain-containi... 92 2e-19 ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein... 92 2e-19 gb|PHT92369.1| BTB/POZ domain-containing protein [Capsicum annuum] 92 4e-19 ref|XP_019239868.1| PREDICTED: BTB/POZ domain-containing protein... 92 4e-19 gb|PIN03996.1| hypothetical protein CDL12_23470 [Handroanthus im... 92 4e-19 >ref|XP_011080923.2| BTB/POZ domain-containing protein At1g63850-like [Sesamum indicum] Length = 659 Score = 97.4 bits (241), Expect = 4e-21 Identities = 48/61 (78%), Positives = 54/61 (88%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR SLD T VEDG++NE+V Sbjct: 356 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSLDVTTGVEDGSDNEEV 415 Query: 184 L 186 L Sbjct: 416 L 416 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LN+ DDCPNI++GFEVWWRR FWR+ Sbjct: 612 DRFLNAGDDCPNIQRGFEVWWRRAFWRR 639 >gb|KVH90128.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 651 Score = 96.7 bits (239), Expect = 8e-21 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKV+SL+ LRLEG+GATEVLKR S+D + V++GNNNE+V Sbjct: 347 GVLSCLEYLEAAPWAEDEEEKVSSLLSELRLEGVGATEVLKRVSVDFSSGVDEGNNNEEV 406 Query: 184 L 186 L Sbjct: 407 L 407 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNSSDDCPNI++ FEVWWRR FWR+ Sbjct: 603 DRFLNSSDDCPNIQRAFEVWWRRAFWRK 630 >gb|POF08562.1| btb/poz domain-containing protein [Quercus suber] Length = 521 Score = 95.5 bits (236), Expect = 2e-20 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR S++ T EDGN+NE+V Sbjct: 219 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSIEVTSGAEDGNDNEEV 278 Query: 184 L 186 L Sbjct: 279 L 279 >ref|XP_023914138.1| BTB/POZ domain-containing protein At1g63850 [Quercus suber] Length = 631 Score = 95.5 bits (236), Expect = 2e-20 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR S++ T EDGN+NE+V Sbjct: 329 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSIEVTSGAEDGNDNEEV 388 Query: 184 L 186 L Sbjct: 389 L 389 >ref|XP_015085210.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Solanum pennellii] Length = 635 Score = 95.1 bits (235), Expect = 3e-20 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR SLD T E GN NE+V Sbjct: 332 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSLDVTSGTESGNGNEEV 391 Query: 184 L 186 L Sbjct: 392 L 392 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FWR+ Sbjct: 588 DRFLNSGDDCPNIQRGFEIWWRRSFWRR 615 >ref|XP_012834299.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Erythranthe guttata] gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Erythranthe guttata] Length = 649 Score = 94.7 bits (234), Expect = 4e-20 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRL+GIGA EVLKR SLD T E+ N+NEQV Sbjct: 345 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLQGIGAREVLKRVSLDATEGAEEANDNEQV 404 Query: 184 L 186 L Sbjct: 405 L 405 Score = 54.3 bits (129), Expect = 5e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 E+ LN DDCPNI++GFE+WWRR FWR+ Sbjct: 601 ERFLNGGDDCPNIQRGFEMWWRRAFWRR 628 >ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Solanum lycopersicum] Length = 638 Score = 94.0 bits (232), Expect = 7e-20 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD T E GN NE+V Sbjct: 335 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLRRVSLDVTSGTESGNGNEEV 394 Query: 184 L 186 L Sbjct: 395 L 395 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FWR+ Sbjct: 591 DRFLNSGDDCPNIQRGFEIWWRRSFWRR 618 >gb|PHT57694.1| BTB/POZ domain-containing protein [Capsicum baccatum] Length = 640 Score = 94.0 bits (232), Expect = 7e-20 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD T E GN NE+V Sbjct: 337 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLRRVSLDVTSGTESGNGNEEV 396 Query: 184 L 186 L Sbjct: 397 L 397 Score = 54.3 bits (129), Expect = 5e-06 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FW++ Sbjct: 593 DRFLNSGDDCPNIQRGFEIWWRRAFWKR 620 >gb|PHU28039.1| BTB/POZ domain-containing protein [Capsicum chinense] Length = 641 Score = 94.0 bits (232), Expect = 7e-20 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD T E GN NE+V Sbjct: 338 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLRRVSLDVTSGTESGNGNEEV 397 Query: 184 L 186 L Sbjct: 398 L 398 Score = 54.3 bits (129), Expect = 5e-06 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FW++ Sbjct: 594 DRFLNSGDDCPNIQRGFEIWWRRAFWKR 621 >ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum tuberosum] Length = 642 Score = 94.0 bits (232), Expect = 7e-20 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD T E GN NE+V Sbjct: 339 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLRRVSLDVTSGTESGNGNEEV 398 Query: 184 L 186 L Sbjct: 399 L 399 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FWR+ Sbjct: 595 DRFLNSGDDCPNIQRGFEIWWRRSFWRR 622 >ref|XP_022862861.1| BTB/POZ domain-containing protein At1g63850 [Olea europaea var. sylvestris] Length = 638 Score = 93.6 bits (231), Expect = 9e-20 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEGIGA EVLKR SLD T V+D ++NE+V Sbjct: 335 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGIGAGEVLKRVSLDVTSGVDDRSDNEEV 394 Query: 184 L 186 L Sbjct: 395 L 395 Score = 55.8 bits (133), Expect = 2e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFEVWWRR FWR+ Sbjct: 591 DRFLNSGDDCPNIQRGFEVWWRRAFWRR 618 >gb|PON62924.1| BTB/POZ domain containing protein [Parasponia andersonii] Length = 690 Score = 93.6 bits (231), Expect = 9e-20 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR S++ T E+GN+NE+V Sbjct: 387 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSIEVTNGTEEGNDNEEV 446 Query: 184 L 186 L Sbjct: 447 L 447 Score = 53.5 bits (127), Expect = 1e-05 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = +1 Query: 184 LNSSDDCPNIRKGFEVWWRRVFWRQ 258 LNS +DCPNI++GFEVWWRR FWR+ Sbjct: 646 LNSGEDCPNIQRGFEVWWRRAFWRR 670 >gb|PON84537.1| BTB/POZ domain containing protein [Trema orientalis] Length = 691 Score = 93.6 bits (231), Expect = 9e-20 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR S++ T E+GN+NE+V Sbjct: 388 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSIEVTNGTEEGNDNEEV 447 Query: 184 L 186 L Sbjct: 448 L 448 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = +1 Query: 184 LNSSDDCPNIRKGFEVWWRRVFWRQ 258 LNSS+DCPNI++GFEVWWRR FWR+ Sbjct: 647 LNSSEDCPNIQRGFEVWWRRAFWRR 671 >ref|XP_023738493.1| BTB/POZ domain-containing protein At1g63850-like [Lactuca sativa] gb|PLY70146.1| hypothetical protein LSAT_3X7001 [Lactuca sativa] Length = 637 Score = 92.8 bits (229), Expect = 2e-19 Identities = 44/61 (72%), Positives = 53/61 (86%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVA+L+ LRLEG+GA EVLKR S+D TP +D N+N++V Sbjct: 351 GVLSCLEYLEAAPWAEDEEEKVAALLSELRLEGVGAGEVLKRVSIDVTPGEDDTNDNQEV 410 Query: 184 L 186 L Sbjct: 411 L 411 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFEVWW+R FWR+ Sbjct: 607 DRFLNSGDDCPNIQRGFEVWWKRAFWRK 634 >ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum tuberosum] Length = 644 Score = 92.8 bits (229), Expect = 2e-19 Identities = 45/61 (73%), Positives = 50/61 (81%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD E GN NE+V Sbjct: 341 GVLSCLEYLEAAPWAEDEEEKVASLLFELRLEGVGAGEVLRRVSLDVASGTESGNGNEEV 400 Query: 184 L 186 L Sbjct: 401 L 401 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FWR+ Sbjct: 597 DRFLNSGDDCPNIQRGFEIWWRRSFWRR 624 >ref|XP_011073126.1| LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g63850 [Sesamum indicum] Length = 615 Score = 92.4 bits (228), Expect = 2e-19 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR SL EDGN+NE+V Sbjct: 312 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAAEVLKRVSLXXXXXXEDGNDNEEV 371 Query: 184 L 186 L Sbjct: 372 L 372 >ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria vesca subsp. vesca] Length = 616 Score = 92.4 bits (228), Expect = 2e-19 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVLKR SL+ E+GN+NE+V Sbjct: 314 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLKRVSLEVANGTEEGNDNEEV 373 Query: 184 L 186 L Sbjct: 374 L 374 >gb|PHT92369.1| BTB/POZ domain-containing protein [Capsicum annuum] Length = 610 Score = 91.7 bits (226), Expect = 4e-19 Identities = 45/61 (73%), Positives = 50/61 (81%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+ A EVL+R SLD T E GN NE+V Sbjct: 307 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVAAGEVLRRVSLDVTSGTESGNGNEEV 366 Query: 184 L 186 L Sbjct: 367 L 367 Score = 54.3 bits (129), Expect = 5e-06 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FW++ Sbjct: 563 DRFLNSGDDCPNIQRGFEIWWRRAFWKR 590 >ref|XP_019239868.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana attenuata] gb|OIT20676.1| btbpoz domain-containing protein [Nicotiana attenuata] Length = 638 Score = 91.7 bits (226), Expect = 4e-19 Identities = 45/61 (73%), Positives = 50/61 (81%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA EVL+R SLD T E N NE+V Sbjct: 335 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGAGEVLRRVSLDVTSGTESANGNEEV 394 Query: 184 L 186 L Sbjct: 395 L 395 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ LNS DDCPNI++GFE+WWRR FWR+ Sbjct: 591 DRFLNSGDDCPNIQRGFEIWWRRAFWRR 618 >gb|PIN03996.1| hypothetical protein CDL12_23470 [Handroanthus impetiginosus] Length = 640 Score = 91.7 bits (226), Expect = 4e-19 Identities = 48/61 (78%), Positives = 54/61 (88%) Frame = +1 Query: 4 GVLSCLEYLEAAPWADDEEEKVASLIIGLRLEGIGATEVLKRGSLDTTPAVEDGNNNEQV 183 GVLSCLEYLEAAPWA+DEEEKVASL+ LRLEG+GA+EVLKR SLD T A ED N+NE+V Sbjct: 338 GVLSCLEYLEAAPWAEDEEEKVASLLSELRLEGVGASEVLKRVSLDVT-AGEDVNDNEEV 396 Query: 184 L 186 L Sbjct: 397 L 397 Score = 54.7 bits (130), Expect = 4e-06 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = +1 Query: 175 EQVLNSSDDCPNIRKGFEVWWRRVFWRQ 258 ++ +NS DDCPNI++GFEVWWRR FWR+ Sbjct: 593 DRFVNSGDDCPNIQRGFEVWWRRAFWRR 620