BLASTX nr result
ID: Rehmannia31_contig00029956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029956 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841482.1| PREDICTED: uncharacterized protein LOC105961... 55 7e-06 ref|XP_012841481.1| PREDICTED: uncharacterized protein LOC105961... 55 7e-06 ref|XP_012841480.1| PREDICTED: uncharacterized protein LOC105961... 55 7e-06 gb|EYU34045.1| hypothetical protein MIMGU_mgv1a002678mg [Erythra... 55 7e-06 >ref|XP_012841482.1| PREDICTED: uncharacterized protein LOC105961764 isoform X3 [Erythranthe guttata] Length = 536 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +2 Query: 2 WILLYAPFKLVLRLCRLVSFLCTFIYGLFGDLWVSARHI 118 W++LY PF+L+ C + SFLC FIY L GD+WVSA+ I Sbjct: 393 WVVLYTPFRLLHGFCSITSFLCAFIYDLGGDVWVSAKSI 431 >ref|XP_012841481.1| PREDICTED: uncharacterized protein LOC105961764 isoform X2 [Erythranthe guttata] Length = 549 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +2 Query: 2 WILLYAPFKLVLRLCRLVSFLCTFIYGLFGDLWVSARHI 118 W++LY PF+L+ C + SFLC FIY L GD+WVSA+ I Sbjct: 477 WVVLYTPFRLLHGFCSITSFLCAFIYDLGGDVWVSAKSI 515 >ref|XP_012841480.1| PREDICTED: uncharacterized protein LOC105961764 isoform X1 [Erythranthe guttata] Length = 620 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +2 Query: 2 WILLYAPFKLVLRLCRLVSFLCTFIYGLFGDLWVSARHI 118 W++LY PF+L+ C + SFLC FIY L GD+WVSA+ I Sbjct: 477 WVVLYTPFRLLHGFCSITSFLCAFIYDLGGDVWVSAKSI 515 >gb|EYU34045.1| hypothetical protein MIMGU_mgv1a002678mg [Erythranthe guttata] Length = 647 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +2 Query: 2 WILLYAPFKLVLRLCRLVSFLCTFIYGLFGDLWVSARHI 118 W++LY PF+L+ C + SFLC FIY L GD+WVSA+ I Sbjct: 518 WVVLYTPFRLLHGFCSITSFLCAFIYDLGGDVWVSAKSI 556