BLASTX nr result
ID: Rehmannia31_contig00029952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029952 (803 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020547874.1| uncharacterized protein LOC105157380 isoform... 57 3e-06 >ref|XP_020547874.1| uncharacterized protein LOC105157380 isoform X2 [Sesamum indicum] Length = 196 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 181 AMICFISRSRWKLKKTQSASYAVQRSEHLQHLR 279 AMICFISRSRWKL+K QS YA QR+EHL HLR Sbjct: 58 AMICFISRSRWKLRKMQSGFYAAQRNEHLLHLR 90