BLASTX nr result
ID: Rehmannia31_contig00029830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029830 (993 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11984.1| hypothetical protein CDL12_15403 [Handroanthus im... 168 8e-43 ref|XP_011076990.1| pentatricopeptide repeat-containing protein ... 167 2e-42 ref|XP_012834492.1| PREDICTED: pentatricopeptide repeat-containi... 159 2e-39 gb|EYU18155.1| hypothetical protein MIMGU_mgv11b014885mg, partia... 133 7e-35 gb|EYU39594.1| hypothetical protein MIMGU_mgv1a0011332mg, partia... 132 3e-33 gb|KZV25109.1| pentatricopeptide repeat-containing protein-like ... 134 2e-32 ref|XP_019183103.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-30 ref|XP_019183101.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-30 ref|XP_019183099.1| PREDICTED: pentatricopeptide repeat-containi... 132 2e-30 emb|CDP13708.1| unnamed protein product [Coffea canephora] 130 1e-29 ref|XP_019232245.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-28 ref|XP_009784911.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-27 ref|XP_015163099.1| PREDICTED: pentatricopeptide repeat-containi... 123 3e-27 ref|XP_022877756.1| pentatricopeptide repeat-containing protein ... 122 6e-27 ref|XP_015061674.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-26 ref|XP_004252127.1| PREDICTED: pentatricopeptide repeat-containi... 119 5e-26 ref|XP_016461860.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-25 ref|XP_009601596.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-25 gb|KZM99399.1| hypothetical protein DCAR_013239 [Daucus carota s... 112 2e-23 ref|XP_017247847.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-23 >gb|PIN11984.1| hypothetical protein CDL12_15403 [Handroanthus impetiginosus] Length = 1128 Score = 168 bits (426), Expect = 8e-43 Identities = 78/108 (72%), Positives = 93/108 (86%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 LD+K LME HG++PDVVTYNVLIT LCRSGD AF+LYEEMK RSVCPNTTT+S+LINA Sbjct: 1008 LDYKLLMERHGAKPDVVTYNVLITALCRSGDTPHAFKLYEEMKLRSVCPNTTTYSVLINA 1067 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 +CSE+DSVKGE IL+DLEERGLV++ S + W +RL+D M NID+LRH Sbjct: 1068 ICSESDSVKGERILIDLEERGLVTQNSTGQDWQQRLSDAMANIDILRH 1115 >ref|XP_011076990.1| pentatricopeptide repeat-containing protein At5g55840 [Sesamum indicum] Length = 1151 Score = 167 bits (423), Expect = 2e-42 Identities = 79/108 (73%), Positives = 93/108 (86%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L+ K LME HG++PDVVTYNVLITGLCR+GD ARAF LYEEMK R +CPN TTFS+L+NA Sbjct: 1027 LNCKLLMECHGAKPDVVTYNVLITGLCRTGDTARAFTLYEEMKLRGICPNITTFSVLVNA 1086 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 +CSEN+SV GESILVDLEERG VS+ S + W++RL+D MVNIDLLRH Sbjct: 1087 ICSENNSVNGESILVDLEERGFVSQNSTGQDWHRRLSDAMVNIDLLRH 1134 >ref|XP_012834492.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Erythranthe guttata] Length = 1116 Score = 159 bits (401), Expect = 2e-39 Identities = 78/108 (72%), Positives = 90/108 (83%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 LD K+LME+HG +PDVVTYNVL+TGLCRSGDIARAF LYEEMK RSVCPN TTF +L++A Sbjct: 1000 LDCKKLMENHGCKPDVVTYNVLLTGLCRSGDIARAFALYEEMKLRSVCPNITTFYVLVSA 1059 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 V SEND V GE IL DLEERGLVS +S ++ WN RL + +VNID LRH Sbjct: 1060 VLSENDCVNGEGILKDLEERGLVSGDSVSRDWNIRLEEAVVNIDRLRH 1107 >gb|EYU18155.1| hypothetical protein MIMGU_mgv11b014885mg, partial [Erythranthe guttata] Length = 137 Score = 133 bits (335), Expect = 7e-35 Identities = 70/108 (64%), Positives = 78/108 (72%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 LD K+LME+HG +PDVV YNVL+TGLCRSGDIARAF LYEEMK RSVCPN TTF +L++A Sbjct: 37 LDCKKLMENHGCKPDVVAYNVLLTGLCRSGDIARAFALYEEMKLRSVCPNITTFYVLVSA 96 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 V SEND V GE IL DLEERGL +VNID LRH Sbjct: 97 VLSENDCVNGEGILKDLEERGL----------------AVVNIDRLRH 128 >gb|EYU39594.1| hypothetical protein MIMGU_mgv1a0011332mg, partial [Erythranthe guttata] Length = 241 Score = 132 bits (332), Expect = 3e-33 Identities = 64/88 (72%), Positives = 73/88 (82%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 LD K+LME+HG +PDVVTYNVL+TGLCRSGDIARAF LYEEMK RSVCPN TTF +L++A Sbjct: 148 LDCKKLMENHGCKPDVVTYNVLLTGLCRSGDIARAFALYEEMKLRSVCPNITTFYVLVSA 207 Query: 813 VCSENDSVKGESILVDLEERGLVSRESN 730 V SEND V GE IL DLEERGL + + Sbjct: 208 VLSENDCVNGEGILKDLEERGLAESKDS 235 >gb|KZV25109.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 401 Score = 134 bits (337), Expect = 2e-32 Identities = 62/107 (57%), Positives = 82/107 (76%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L+ K LMEH+G++PDVV YNVLITGLC+ D + AF LYEEMKQR +CPN TTF++L++A Sbjct: 289 LNVKYLMEHYGAKPDVVAYNVLITGLCKIHDTSHAFRLYEEMKQRGICPNITTFAVLVDA 348 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 + SEN+S G+SIL DLEERGLV++ S W +L DVM + L++ Sbjct: 349 IYSENNSTMGQSILTDLEERGLVNQNSATLGWQGKLIDVMKTVKLIQ 395 >ref|XP_019183103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X3 [Ipomoea nil] Length = 979 Score = 132 bits (333), Expect = 1e-30 Identities = 64/107 (59%), Positives = 84/107 (78%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG+ PDVV YNVLITGLC +GDI +AF+LYEEMKQR++CPN TTF+ L+NA Sbjct: 847 LKLKEAMELHGANPDVVVYNVLITGLCVNGDIDQAFDLYEEMKQRAICPNITTFATLVNA 906 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 V S ND +KGE++LVDL ERGL++++ +A ++RLT VM ++ LR Sbjct: 907 VQSGNDPLKGETLLVDLRERGLITQKPGPEAIHERLTVVMQKLNFLR 953 >ref|XP_019183101.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Ipomoea nil] ref|XP_019183102.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Ipomoea nil] Length = 1016 Score = 132 bits (333), Expect = 1e-30 Identities = 64/107 (59%), Positives = 84/107 (78%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG+ PDVV YNVLITGLC +GDI +AF+LYEEMKQR++CPN TTF+ L+NA Sbjct: 884 LKLKEAMELHGANPDVVVYNVLITGLCVNGDIDQAFDLYEEMKQRAICPNITTFATLVNA 943 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 V S ND +KGE++LVDL ERGL++++ +A ++RLT VM ++ LR Sbjct: 944 VQSGNDPLKGETLLVDLRERGLITQKPGPEAIHERLTVVMQKLNFLR 990 >ref|XP_019183099.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Ipomoea nil] ref|XP_019183100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Ipomoea nil] Length = 1147 Score = 132 bits (333), Expect = 2e-30 Identities = 64/107 (59%), Positives = 84/107 (78%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG+ PDVV YNVLITGLC +GDI +AF+LYEEMKQR++CPN TTF+ L+NA Sbjct: 1015 LKLKEAMELHGANPDVVVYNVLITGLCVNGDIDQAFDLYEEMKQRAICPNITTFATLVNA 1074 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 V S ND +KGE++LVDL ERGL++++ +A ++RLT VM ++ LR Sbjct: 1075 VQSGNDPLKGETLLVDLRERGLITQKPGPEAIHERLTVVMQKLNFLR 1121 >emb|CDP13708.1| unnamed protein product [Coffea canephora] Length = 1156 Score = 130 bits (327), Expect = 1e-29 Identities = 61/106 (57%), Positives = 82/106 (77%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L+ K +ME HG +PD VTYNVLI+GLC SGD +AF+LY+EMKQR +CP TTF +L++A Sbjct: 1024 LELKTIMELHGRKPDAVTYNVLISGLCVSGDKLQAFDLYKEMKQRDLCPTVTTFRVLLHA 1083 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLL 676 V SENDSVKG+++LVDL+ERGL+S++ +A+ W K M +D L Sbjct: 1084 VSSENDSVKGKTLLVDLQERGLISQDLDAQLWCKTSVVAMEKLDFL 1129 >ref|XP_019232245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana attenuata] ref|XP_019232246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana attenuata] ref|XP_019232247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana attenuata] ref|XP_019232248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana attenuata] gb|OIT28186.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 1112 Score = 127 bits (319), Expect = 1e-28 Identities = 61/107 (57%), Positives = 79/107 (73%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K M+ HG++PDV+ YNVLITGLC G I AF+LYEE+K+RS+CPN TTF++L+NA Sbjct: 999 LKLKATMDLHGAKPDVIVYNVLITGLCAGGCIDHAFDLYEELKERSLCPNVTTFTVLVNA 1058 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 VCS ND KGES+L DL+ERGL S+ +A +RLT V ++ LR Sbjct: 1059 VCSANDLAKGESLLSDLQERGLAGEYSSTEALCERLTVVREKLNALR 1105 >ref|XP_009784911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana sylvestris] ref|XP_009784912.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana sylvestris] ref|XP_016451417.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] Length = 1112 Score = 124 bits (311), Expect = 1e-27 Identities = 60/107 (56%), Positives = 78/107 (72%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K M+ HG++ DV+ YNVLITGLC G I AF+LYEE+K+RS+CPN TTF++L+NA Sbjct: 999 LKLKATMDLHGAKADVIVYNVLITGLCAGGCIDHAFDLYEELKERSLCPNVTTFTVLVNA 1058 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 VCS ND KGES+L DL+ERGL S+ +A +RLT V ++ LR Sbjct: 1059 VCSANDLAKGESLLSDLQERGLAGEYSSTEALCERLTVVREKLNALR 1105 >ref|XP_015163099.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum tuberosum] ref|XP_015163100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum tuberosum] ref|XP_015163101.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum tuberosum] ref|XP_015163102.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum tuberosum] Length = 1112 Score = 123 bits (308), Expect = 3e-27 Identities = 60/107 (56%), Positives = 78/107 (72%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG++PDV+ YNVLITGLC G I A++LYEE+K+R +CPN TTF++L+NA Sbjct: 999 LKLKTTMELHGAKPDVIAYNVLITGLCAGGYIDDAYDLYEELKERGMCPNITTFTVLLNA 1058 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 CS ND KGE++L DL+ERGLV SN +A +RLT V ++ LR Sbjct: 1059 FCSGNDLAKGENLLNDLQERGLVGEYSNNQALCERLTIVKEKLNALR 1105 >ref|XP_022877756.1| pentatricopeptide repeat-containing protein At5g55840 [Olea europaea var. sylvestris] ref|XP_022877757.1| pentatricopeptide repeat-containing protein At5g55840 [Olea europaea var. sylvestris] ref|XP_022877758.1| pentatricopeptide repeat-containing protein At5g55840 [Olea europaea var. sylvestris] ref|XP_022877759.1| pentatricopeptide repeat-containing protein At5g55840 [Olea europaea var. sylvestris] Length = 1136 Score = 122 bits (306), Expect = 6e-27 Identities = 56/105 (53%), Positives = 79/105 (75%) Frame = -1 Query: 984 KRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINAVCS 805 K LME HG++PDVV YNVLIT LC++GD AF+LY+EMK+R V PN TTFSIL +A+ S Sbjct: 1023 KDLMEFHGAKPDVVAYNVLITALCQAGDTNNAFKLYDEMKKRGVYPNITTFSILTSAISS 1082 Query: 804 ENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 ND +KGE++L+DL+ +GL+S+ S + W +RL M ++ ++H Sbjct: 1083 GNDPMKGETLLMDLKLKGLISQNSTTEVWQRRLMHAMKKLNHIKH 1127 >ref|XP_015061674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061676.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061677.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061678.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061679.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061680.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] ref|XP_015061683.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum pennellii] Length = 1121 Score = 120 bits (300), Expect = 3e-26 Identities = 58/107 (54%), Positives = 77/107 (71%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG++PDV+ YNVLITGLC G I A++LYEE+K+R +CPN TTF++L+NA Sbjct: 1008 LKLKTTMELHGAKPDVIAYNVLITGLCAGGYIDDAYDLYEELKERGMCPNITTFTVLLNA 1067 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 CS ND KGE++L DL+ERGL SN +A +RLT + ++ LR Sbjct: 1068 FCSGNDLAKGENLLNDLQERGLEGEFSNTQALCERLTIMKEKLNALR 1114 >ref|XP_004252127.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313940.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313941.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313946.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_010313947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_019067143.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] ref|XP_019067144.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] Length = 1121 Score = 119 bits (299), Expect = 5e-26 Identities = 58/107 (54%), Positives = 76/107 (71%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K ME HG +PDV+ YNVLITGLC G I A++LYEE+K+R +CPN TTF++L+NA Sbjct: 1008 LKLKTTMELHGGKPDVIAYNVLITGLCAGGYIDDAYDLYEELKERGMCPNITTFTVLLNA 1067 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 CS ND KGE++L DL+ERGL SN +A +RLT + ++ LR Sbjct: 1068 FCSGNDLAKGENLLNDLQERGLEGEFSNTQALCERLTIMKEKLNALR 1114 >ref|XP_016461860.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] ref|XP_016461861.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] ref|XP_016461862.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] ref|XP_016461863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] ref|XP_016461864.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] ref|XP_016461865.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like [Nicotiana tabacum] Length = 1111 Score = 118 bits (295), Expect = 2e-25 Identities = 57/107 (53%), Positives = 75/107 (70%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K M+ HG++ DV+ YNVLITGLC G I AF+LYEE+K+R +CPN TTF++L+NA Sbjct: 998 LKLKATMDLHGAKADVIVYNVLITGLCAGGCIDHAFDLYEELKERGLCPNVTTFTVLVNA 1057 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 VCS ND KGES+L DL+ERGL S+ +A + L V ++ LR Sbjct: 1058 VCSANDLAKGESLLSDLQERGLAGEYSSTEALCEGLAVVSEKLNALR 1104 >ref|XP_009601596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] ref|XP_009601597.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] ref|XP_009601598.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] ref|XP_009601599.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] ref|XP_018626569.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] ref|XP_018626570.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Nicotiana tomentosiformis] Length = 1111 Score = 118 bits (295), Expect = 2e-25 Identities = 57/107 (53%), Positives = 75/107 (70%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L K M+ HG++ DV+ YNVLITGLC G I AF+LYEE+K+R +CPN TTF++L+NA Sbjct: 998 LKLKATMDLHGAKADVIVYNVLITGLCAGGCIDHAFDLYEELKERGLCPNVTTFTVLVNA 1057 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLR 673 VCS ND KGES+L DL+ERGL S+ +A + L V ++ LR Sbjct: 1058 VCSANDLAKGESLLSDLQERGLAGEYSSTEALCEGLAVVSEKLNALR 1104 >gb|KZM99399.1| hypothetical protein DCAR_013239 [Daucus carota subsp. sativus] Length = 715 Score = 112 bits (279), Expect = 2e-23 Identities = 53/108 (49%), Positives = 75/108 (69%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L+ K +ME HG + DVV YNV+ITGLC G+ AFELYEEMKQ+ +CPNTT+F +L+ A Sbjct: 598 LNLKDVMELHGVKLDVVAYNVMITGLCAVGEADHAFELYEEMKQKGLCPNTTSFYVLVKA 657 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 V + S+KGE +L+D+ ERGL+S ++ + + L M ++ LRH Sbjct: 658 VSEDKFSLKGEMLLIDMRERGLLSEDNITQGLQEGLVVAMEKLESLRH 705 >ref|XP_017247847.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Daucus carota subsp. sativus] Length = 1136 Score = 112 bits (279), Expect = 2e-23 Identities = 53/108 (49%), Positives = 75/108 (69%) Frame = -1 Query: 993 LDFKRLMEHHGSQPDVVTYNVLITGLCRSGDIARAFELYEEMKQRSVCPNTTTFSILINA 814 L+ K +ME HG + DVV YNV+ITGLC G+ AFELYEEMKQ+ +CPNTT+F +L+ A Sbjct: 1019 LNLKDVMELHGVKLDVVAYNVMITGLCAVGEADHAFELYEEMKQKGLCPNTTSFYVLVKA 1078 Query: 813 VCSENDSVKGESILVDLEERGLVSRESNAKAWNKRLTDVMVNIDLLRH 670 V + S+KGE +L+D+ ERGL+S ++ + + L M ++ LRH Sbjct: 1079 VSEDKFSLKGEMLLIDMRERGLLSEDNITQGLQEGLVVAMEKLESLRH 1126