BLASTX nr result
ID: Rehmannia31_contig00029718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029718 (726 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07634.1| hypothetical protein CDL12_19802 [Handroanthus im... 60 4e-07 ref|XP_012836837.1| PREDICTED: uncharacterized protein LOC105957... 58 2e-06 >gb|PIN07634.1| hypothetical protein CDL12_19802 [Handroanthus impetiginosus] Length = 218 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/43 (69%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -1 Query: 726 SYSRRNGVTSGAETNLSGQREKSMALNSEGLE--VGRFQFLIS 604 +YSRRNG+T GAE+NLS QREKSMALNSEGLE + R +FL++ Sbjct: 111 NYSRRNGITMGAESNLSNQREKSMALNSEGLEGLIPRAKFLLT 153 >ref|XP_012836837.1| PREDICTED: uncharacterized protein LOC105957463 [Erythranthe guttata] gb|EYU37543.1| hypothetical protein MIMGU_mgv1a013536mg [Erythranthe guttata] Length = 217 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 726 SYSRRNGVTSGAETNLSGQREKSMALNSEGLE 631 SYSRRNGVT+GAE +LS QREKSMALNSEGLE Sbjct: 110 SYSRRNGVTTGAEADLSNQREKSMALNSEGLE 141