BLASTX nr result
ID: Rehmannia31_contig00029566
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029566 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04389.1| hypothetical protein CDL12_23072 [Handroanthus im... 53 2e-06 >gb|PIN04389.1| hypothetical protein CDL12_23072 [Handroanthus impetiginosus] Length = 72 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/60 (43%), Positives = 33/60 (55%) Frame = +1 Query: 85 NIDNIIIQXXXXXXXXXXXXXXXRRAVNKTVTSLPTKCKIYAQDQFQEDLPRFCADLVWP 264 N+DN++ ++A +KT SLPT CK DQFQE+LPR C DLVWP Sbjct: 16 NLDNLMSLPPPNSAATAPPSPAAKKAASKTERSLPTNCK---NDQFQEELPRVCVDLVWP 72