BLASTX nr result
ID: Rehmannia31_contig00029525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029525 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99722.1| hypothetical protein CDL12_27782 [Handroanthus im... 69 3e-11 ref|XP_011086869.1| coiled-coil domain-containing protein SCD2 [... 67 2e-10 gb|KZV20609.1| hypothetical protein F511_32112 [Dorcoceras hygro... 57 5e-07 ref|XP_022851594.1| coiled-coil domain-containing protein SCD2 [... 56 2e-06 gb|EPS73766.1| hypothetical protein M569_00990, partial [Genlise... 55 2e-06 gb|EYU37358.1| hypothetical protein MIMGU_mgv1a004629mg [Erythra... 55 2e-06 ref|XP_012837521.1| PREDICTED: coiled-coil domain-containing pro... 55 2e-06 ref|XP_024194606.1| coiled-coil domain-containing protein SCD2 [... 54 6e-06 >gb|PIM99722.1| hypothetical protein CDL12_27782 [Handroanthus impetiginosus] Length = 555 Score = 69.3 bits (168), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 210 MEKMRQWSSESGGGSPARGSHVRSSSASGISNIKRT 103 MEKMRQWSSESGG SPARGSHVRSSS SGISNIKR+ Sbjct: 1 MEKMRQWSSESGGASPARGSHVRSSSVSGISNIKRS 36 >ref|XP_011086869.1| coiled-coil domain-containing protein SCD2 [Sesamum indicum] ref|XP_020552056.1| coiled-coil domain-containing protein SCD2 [Sesamum indicum] Length = 557 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 210 MEKMRQWSSESGGGSPARGSHVRSSSASGISNIKRT 103 ME++RQWSSESGGGSPARGSHVRSSS SG+S+IKRT Sbjct: 1 MERVRQWSSESGGGSPARGSHVRSSSVSGMSSIKRT 36 >gb|KZV20609.1| hypothetical protein F511_32112 [Dorcoceras hygrometricum] Length = 563 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 210 MEKMRQWSSESGGGSPARGSHVRSSSASGISNIKRT 103 MEK R WS+ESGGGSP +H RSSS SGISNIKRT Sbjct: 1 MEKHRHWSNESGGGSPVHRNHSRSSSGSGISNIKRT 36 >ref|XP_022851594.1| coiled-coil domain-containing protein SCD2 [Olea europaea var. sylvestris] Length = 568 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 201 MRQWSSESGGGSPARGSHVRSSSASGISNIKRT 103 +R WSSESG SPARG+H RSSS SGISNIKRT Sbjct: 12 VRHWSSESGSSSPARGNHSRSSSVSGISNIKRT 44 >gb|EPS73766.1| hypothetical protein M569_00990, partial [Genlisea aurea] Length = 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 210 MEKMRQWSSESGGGSPARGSHVRSSSASGISNIKRT 103 MEKMRQWS+E G SPAR H RSSS S ISNIKRT Sbjct: 1 MEKMRQWSAEPAGASPARVQHGRSSSVSSISNIKRT 36 >gb|EYU37358.1| hypothetical protein MIMGU_mgv1a004629mg [Erythranthe guttata] Length = 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -2 Query: 210 MEKMRQWSSESGGG-SPARGSHVRSSSASGISNIKR 106 MEKMRQW S+SGGG SP RG H R+SS SGIS IKR Sbjct: 1 MEKMRQWGSDSGGGGSPVRGHHARASSVSGISTIKR 36 >ref|XP_012837521.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Erythranthe guttata] Length = 544 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -2 Query: 210 MEKMRQWSSESGGG-SPARGSHVRSSSASGISNIKR 106 MEKMRQW S+SGGG SP RG H R+SS SGIS IKR Sbjct: 1 MEKMRQWGSDSGGGGSPVRGHHARASSVSGISTIKR 36 >ref|XP_024194606.1| coiled-coil domain-containing protein SCD2 [Rosa chinensis] gb|PRQ39793.1| hypothetical protein RchiOBHm_Chr4g0429091 [Rosa chinensis] Length = 552 Score = 54.3 bits (129), Expect = 6e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 6/38 (15%) Frame = -2 Query: 198 RQWSSESGGG------SPARGSHVRSSSASGISNIKRT 103 RQW+SESGGG SP RG H RSSSASGISNIKRT Sbjct: 14 RQWTSESGGGATSPAMSPVRGHHARSSSASGISNIKRT 51