BLASTX nr result
ID: Rehmannia31_contig00029487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029487 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN15504.1| hypothetical protein CDL12_11858 [Handroanthus im... 69 2e-10 ref|XP_011090831.1| pentatricopeptide repeat-containing protein ... 69 2e-10 ref|XP_012827854.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-09 gb|EYU43850.1| hypothetical protein MIMGU_mgv1a018606mg, partial... 60 2e-07 >gb|PIN15504.1| hypothetical protein CDL12_11858 [Handroanthus impetiginosus] Length = 639 Score = 68.6 bits (166), Expect = 2e-10 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 485 DRFDDALYVLGSMLNMGFVLGESICHSLVDKLCRDNSHHHMGTSLEKIL 339 DR+DDAL+VLG ML MG++LGE I HSLVDKLCRD+S H+ TSL +IL Sbjct: 589 DRYDDALFVLGHMLKMGYLLGECISHSLVDKLCRDSS-RHVETSLGEIL 636 >ref|XP_011090831.1| pentatricopeptide repeat-containing protein At5g18950 [Sesamum indicum] Length = 640 Score = 68.6 bits (166), Expect = 2e-10 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -1 Query: 485 DRFDDALYVLGSMLNMGFVLGESICHSLVDKLCRDNSHHHMGTSLEKILEKR 330 DR DDAL+VLG L MG VL +S CHSLVDKLCR+NS HH T L +ILE+R Sbjct: 590 DRSDDALFVLGYTLKMGIVLKQSSCHSLVDKLCRNNS-HHTNTLLGEILERR 640 >ref|XP_012827854.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950 [Erythranthe guttata] Length = 680 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -1 Query: 485 DRFDDALYVLGSMLNMGFVLGESICHSLVDKLCRDNSHHHMGTSLEKILEKR 330 + FDDAL+VL ML MGFVL ESIC SLV+KLCRDN H + SL++ILE+R Sbjct: 630 EMFDDALFVLEHMLKMGFVLRESICFSLVEKLCRDNP-HLVRKSLDEILERR 680 >gb|EYU43850.1| hypothetical protein MIMGU_mgv1a018606mg, partial [Erythranthe guttata] Length = 377 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 485 DRFDDALYVLGSMLNMGFVLGESICHSLVDKLCRDNSH 372 + FDDAL+VL ML MGFVL ESIC SLV+KLCRDN H Sbjct: 339 EMFDDALFVLEHMLKMGFVLRESICFSLVEKLCRDNPH 376