BLASTX nr result
ID: Rehmannia31_contig00029440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029440 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26309.1| Karyopherin (importin) beta 1 [Handroanthus impet... 79 1e-14 ref|XP_012832205.1| PREDICTED: importin subunit beta-1-like [Ery... 75 4e-13 ref|XP_022891860.1| importin subunit beta-1-like, partial [Olea ... 74 5e-13 ref|XP_022880912.1| importin subunit beta-1 [Olea europaea var. ... 74 1e-12 gb|POE97901.1| importin subunit beta-1 [Quercus suber] 72 3e-12 ref|XP_011095057.1| importin subunit beta-1-like [Sesamum indicum] 72 4e-12 ref|XP_023922462.1| importin subunit beta-1 [Quercus suber] 72 5e-12 gb|PIN13366.1| Karyopherin (importin) beta 1 [Handroanthus impet... 72 5e-12 ref|XP_023729711.1| importin subunit beta-1 [Lactuca sativa] >gi... 71 7e-12 ref|XP_020553520.1| importin subunit beta-1-like [Sesamum indicum] 71 7e-12 gb|KZV40169.1| importin subunit beta-1 [Dorcoceras hygrometricum] 70 2e-11 gb|OMO59998.1| hypothetical protein CCACVL1_24483, partial [Corc... 67 3e-11 ref|XP_016485217.1| PREDICTED: importin subunit beta-1-like isof... 69 3e-11 ref|XP_016485215.1| PREDICTED: importin subunit beta-1-like isof... 69 3e-11 ref|XP_009593599.1| PREDICTED: importin subunit beta-1-like [Nic... 69 3e-11 gb|PPR94392.1| hypothetical protein GOBAR_AA26273 [Gossypium bar... 69 3e-11 gb|PPD97731.1| hypothetical protein GOBAR_DD05241 [Gossypium bar... 69 3e-11 gb|AID68439.1| putative importin subunit beta-1, partial [Hyperi... 69 4e-11 gb|KVI11414.1| Armadillo-like helical [Cynara cardunculus var. s... 69 6e-11 ref|XP_002309153.2| hypothetical protein POPTR_0006s10420g [Popu... 68 8e-11 >gb|PIN26309.1| Karyopherin (importin) beta 1 [Handroanthus impetiginosus] Length = 874 Score = 79.0 bits (193), Expect = 1e-14 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLLSAQSPDAKVRTEAE IL QFQ QNLPGFLLSLSV Sbjct: 1 MALEITQYLLSAQSPDAKVRTEAETILRQFQEQNLPGFLLSLSV 44 >ref|XP_012832205.1| PREDICTED: importin subunit beta-1-like [Erythranthe guttata] gb|EYU41939.1| hypothetical protein MIMGU_mgv1a001166mg [Erythranthe guttata] Length = 874 Score = 74.7 bits (182), Expect = 4e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLS 357 MALEITQYLLSAQSPDAKVR +AE L QFQNQNLPGFLLSLS Sbjct: 1 MALEITQYLLSAQSPDAKVRNDAETALGQFQNQNLPGFLLSLS 43 >ref|XP_022891860.1| importin subunit beta-1-like, partial [Olea europaea var. sylvestris] Length = 677 Score = 74.3 bits (181), Expect = 5e-13 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLL+AQSPDAK+RTEAE+ L QF++QNLPGFLLSLSV Sbjct: 1 MALEITQYLLAAQSPDAKIRTEAESSLGQFRDQNLPGFLLSLSV 44 >ref|XP_022880912.1| importin subunit beta-1 [Olea europaea var. sylvestris] Length = 874 Score = 73.6 bits (179), Expect = 1e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLL+AQSPDAK+RTEAE+ L QF++QN+PGFLLSLSV Sbjct: 1 MALEITQYLLAAQSPDAKIRTEAESALGQFRDQNVPGFLLSLSV 44 >gb|POE97901.1| importin subunit beta-1 [Quercus suber] Length = 1119 Score = 72.4 bits (176), Expect = 3e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 226 KMALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 +MALEITQ+LLSAQSPDA VRTEAEA L +FQ QNLP FLLSLSV Sbjct: 247 RMALEITQFLLSAQSPDANVRTEAEANLTRFQEQNLPSFLLSLSV 291 >ref|XP_011095057.1| importin subunit beta-1-like [Sesamum indicum] Length = 874 Score = 72.0 bits (175), Expect = 4e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLLSAQSPDA +R EAE L QF++QNLPGFLLSLSV Sbjct: 1 MALEITQYLLSAQSPDANIRNEAETTLSQFRDQNLPGFLLSLSV 44 >ref|XP_023922462.1| importin subunit beta-1 [Quercus suber] Length = 872 Score = 71.6 bits (174), Expect = 5e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LLSAQSPDA VRTEAEA L +FQ QNLP FLLSLSV Sbjct: 1 MALEITQFLLSAQSPDANVRTEAEANLTRFQEQNLPSFLLSLSV 44 >gb|PIN13366.1| Karyopherin (importin) beta 1 [Handroanthus impetiginosus] Length = 874 Score = 71.6 bits (174), Expect = 5e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLLSAQSPDAKVR EAE L QF++QNLP FLLSLSV Sbjct: 1 MALEITQYLLSAQSPDAKVRNEAETTLGQFRDQNLPAFLLSLSV 44 >ref|XP_023729711.1| importin subunit beta-1 [Lactuca sativa] gb|PLY77045.1| hypothetical protein LSAT_8X101881 [Lactuca sativa] Length = 872 Score = 71.2 bits (173), Expect = 7e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MA+EIT++LLSAQSPDAKVRTEAE L QFQ QNLPGFLLSLS+ Sbjct: 1 MAVEITEFLLSAQSPDAKVRTEAEVRLRQFQEQNLPGFLLSLSL 44 >ref|XP_020553520.1| importin subunit beta-1-like [Sesamum indicum] Length = 874 Score = 71.2 bits (173), Expect = 7e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQYLLSAQSPDAKVR EAE L QF++QNL GFLLSLSV Sbjct: 1 MALEITQYLLSAQSPDAKVRNEAETTLSQFRDQNLSGFLLSLSV 44 >gb|KZV40169.1| importin subunit beta-1 [Dorcoceras hygrometricum] Length = 795 Score = 69.7 bits (169), Expect = 2e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MA+EITQYLLSAQSPDA VRT AE L QF++QNLPGFLLSLSV Sbjct: 1 MAMEITQYLLSAQSPDANVRTGAENTLGQFRDQNLPGFLLSLSV 44 >gb|OMO59998.1| hypothetical protein CCACVL1_24483, partial [Corchorus capsularis] Length = 172 Score = 67.0 bits (162), Expect = 3e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MA+EITQ+LL+AQS DAKVRTEAE+ L QFQ QNLP FLLSLSV Sbjct: 1 MAMEITQFLLAAQSADAKVRTEAESSLRQFQEQNLPVFLLSLSV 44 >ref|XP_016485217.1| PREDICTED: importin subunit beta-1-like isoform X2 [Nicotiana tabacum] Length = 874 Score = 69.3 bits (168), Expect = 3e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LL+AQS DAK+RTEAEA L QF+ QNLPGFLLSL+V Sbjct: 1 MALEITQFLLAAQSADAKIRTEAEANLSQFREQNLPGFLLSLAV 44 >ref|XP_016485215.1| PREDICTED: importin subunit beta-1-like isoform X1 [Nicotiana tabacum] ref|XP_016485216.1| PREDICTED: importin subunit beta-1-like isoform X1 [Nicotiana tabacum] Length = 874 Score = 69.3 bits (168), Expect = 3e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LL+AQS DAK+RTEAEA L QF+ QNLPGFLLSL+V Sbjct: 1 MALEITQFLLAAQSADAKIRTEAEANLSQFREQNLPGFLLSLAV 44 >ref|XP_009593599.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis] ref|XP_009593600.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis] ref|XP_009593601.1| PREDICTED: importin subunit beta-1-like [Nicotiana tomentosiformis] Length = 874 Score = 69.3 bits (168), Expect = 3e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LL+AQS DAK+RTEAEA L QF+ QNLPGFLLSL+V Sbjct: 1 MALEITQFLLAAQSADAKIRTEAEANLSQFREQNLPGFLLSLAV 44 >gb|PPR94392.1| hypothetical protein GOBAR_AA26273 [Gossypium barbadense] Length = 884 Score = 69.3 bits (168), Expect = 3e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 226 KMALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 KMA+EITQ+LL+AQS DAKVRTEAEA L QFQ QN+P FLLSLSV Sbjct: 22 KMAMEITQFLLAAQSADAKVRTEAEASLRQFQEQNMPVFLLSLSV 66 >gb|PPD97731.1| hypothetical protein GOBAR_DD05241 [Gossypium barbadense] Length = 894 Score = 69.3 bits (168), Expect = 3e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 226 KMALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 KMA+EITQ+LL+AQS DAKVRTEAEA L QFQ QN+P FLLSLSV Sbjct: 22 KMAMEITQFLLAAQSADAKVRTEAEASLRQFQEQNMPVFLLSLSV 66 >gb|AID68439.1| putative importin subunit beta-1, partial [Hypericum perforatum] Length = 331 Score = 68.6 bits (166), Expect = 4e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LLSAQSPDA VRT+AE+ L QFQ QNLP FLLSLSV Sbjct: 1 MALEITQFLLSAQSPDASVRTQAESNLKQFQEQNLPLFLLSLSV 44 >gb|KVI11414.1| Armadillo-like helical [Cynara cardunculus var. scolymus] Length = 792 Score = 68.6 bits (166), Expect = 6e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MA+EIT++LLSAQS DAKVRTEAE+ L QFQ QNLPGFLLSLS+ Sbjct: 1 MAVEITEFLLSAQSADAKVRTEAESRLRQFQEQNLPGFLLSLSL 44 >ref|XP_002309153.2| hypothetical protein POPTR_0006s10420g [Populus trichocarpa] gb|PNT30852.1| hypothetical protein POPTR_006G103300v3 [Populus trichocarpa] Length = 870 Score = 68.2 bits (165), Expect = 8e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +1 Query: 229 MALEITQYLLSAQSPDAKVRTEAEAILVQFQNQNLPGFLLSLSV 360 MALEITQ+LL+AQSPDA +RT+AEA L QFQ QNLP FLLSLSV Sbjct: 1 MALEITQFLLAAQSPDANIRTQAEASLRQFQEQNLPLFLLSLSV 44