BLASTX nr result
ID: Rehmannia31_contig00029213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029213 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098007.1| subtilisin-like protease SBT3.5 [Sesamum ind... 65 1e-09 ref|XP_022884641.1| subtilisin-like protease SBT3.5 isoform X1 [... 59 1e-07 >ref|XP_011098007.1| subtilisin-like protease SBT3.5 [Sesamum indicum] Length = 764 Score = 65.1 bits (157), Expect = 1e-09 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 5/49 (10%) Frame = -2 Query: 132 MGSSRNSQKMVLYLF----LFLAVISPSFSSKLYVVYMGSS-GSDGPDE 1 MGSS N+ +MVLYL+ +FLAVI PS SSKLYVVYMGSS GSDGPDE Sbjct: 1 MGSSTNAPRMVLYLYFSLCVFLAVIGPSVSSKLYVVYMGSSRGSDGPDE 49 >ref|XP_022884641.1| subtilisin-like protease SBT3.5 isoform X1 [Olea europaea var. sylvestris] Length = 764 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -2 Query: 132 MGSSRNSQKMVL---YLFLFLAVISPSFSSKLYVVYMGSSGSDGPDE 1 MGS RN++ VL +L +FL VISPS SS+LYVVYMGS GSD PDE Sbjct: 1 MGSYRNTRNRVLLSLFLLVFLEVISPSVSSELYVVYMGSKGSDDPDE 47