BLASTX nr result
ID: Rehmannia31_contig00029069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029069 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075100.1| gamma-tubulin complex component 3 [Sesamum i... 106 3e-24 gb|PIM97651.1| Gamma-tubulin complex, DGRIP91/SPC98 component [H... 102 7e-23 gb|EYU39957.1| hypothetical protein MIMGU_mgv1a001233mg [Erythra... 101 2e-22 ref|XP_012834406.1| PREDICTED: gamma-tubulin complex component 3... 101 2e-22 gb|KZV37926.1| gamma-tubulin complex component 3 [Dorcoceras hyg... 93 1e-19 ref|XP_019253651.1| PREDICTED: gamma-tubulin complex component 3... 89 4e-18 ref|XP_016498721.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubuli... 89 4e-18 ref|XP_009765947.1| PREDICTED: gamma-tubulin complex component 3... 89 4e-18 ref|XP_019165843.1| PREDICTED: gamma-tubulin complex component 3... 89 4e-18 emb|CDP10165.1| unnamed protein product [Coffea canephora] 89 4e-18 ref|XP_016505980.1| PREDICTED: gamma-tubulin complex component 3... 87 1e-17 ref|XP_009605602.1| PREDICTED: gamma-tubulin complex component 3... 87 2e-17 ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3... 87 2e-17 gb|PHU06369.1| Gamma-tubulin complex component 3 [Capsicum chine... 86 3e-17 gb|PHT71686.1| Gamma-tubulin complex component 3 [Capsicum annuum] 86 3e-17 ref|XP_010325937.1| PREDICTED: gamma-tubulin complex component 3... 86 3e-17 ref|XP_016541058.1| PREDICTED: gamma-tubulin complex component 3... 86 3e-17 ref|XP_015086188.1| PREDICTED: gamma-tubulin complex component 3... 86 5e-17 ref|XP_024190792.1| gamma-tubulin complex component 3 [Rosa chin... 85 8e-17 gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] 85 1e-16 >ref|XP_011075100.1| gamma-tubulin complex component 3 [Sesamum indicum] Length = 927 Score = 106 bits (264), Expect = 3e-24 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL 160 IDAIAKEYSSVF+GFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL Sbjct: 875 IDAIAKEYSSVFDGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL 927 >gb|PIM97651.1| Gamma-tubulin complex, DGRIP91/SPC98 component [Handroanthus impetiginosus] Length = 943 Score = 102 bits (254), Expect = 7e-23 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLL 157 IDAIAKEYSSVFEGFISQLP+QQHVDLKFLMFRLDFTEFY QLRPSTGGK L Sbjct: 891 IDAIAKEYSSVFEGFISQLPVQQHVDLKFLMFRLDFTEFYGQLRPSTGGKFL 942 >gb|EYU39957.1| hypothetical protein MIMGU_mgv1a001233mg [Erythranthe guttata] Length = 858 Score = 101 bits (251), Expect = 2e-22 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL 160 I+AI KEYSS+FEGFISQLPIQQHVDLKFLMFRLDFTEFY+QLRPSTGGKL L Sbjct: 806 IEAIGKEYSSIFEGFISQLPIQQHVDLKFLMFRLDFTEFYTQLRPSTGGKLFL 858 >ref|XP_012834406.1| PREDICTED: gamma-tubulin complex component 3 [Erythranthe guttata] Length = 929 Score = 101 bits (251), Expect = 2e-22 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL 160 I+AI KEYSS+FEGFISQLPIQQHVDLKFLMFRLDFTEFY+QLRPSTGGKL L Sbjct: 877 IEAIGKEYSSIFEGFISQLPIQQHVDLKFLMFRLDFTEFYTQLRPSTGGKLFL 929 >gb|KZV37926.1| gamma-tubulin complex component 3 [Dorcoceras hygrometricum] Length = 770 Score = 93.2 bits (230), Expect = 1e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLLL 160 +DA ++EYSS+FEGFISQLPIQQHVDLKFLMFRLDFTEFYSQL+ + GGK+LL Sbjct: 718 VDATSQEYSSLFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLKSTAGGKILL 770 >ref|XP_019253651.1| PREDICTED: gamma-tubulin complex component 3 [Nicotiana attenuata] gb|OIS98885.1| gamma-tubulin complex component 3 [Nicotiana attenuata] Length = 904 Score = 89.0 bits (219), Expect = 4e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQLRP T G L Sbjct: 853 IDAIGKDYATIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQLRPITRGNL 903 >ref|XP_016498721.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubulin complex component 3-like [Nicotiana tabacum] Length = 907 Score = 89.0 bits (219), Expect = 4e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQLRP T G L Sbjct: 856 IDAIGKDYATIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQLRPITRGNL 906 >ref|XP_009765947.1| PREDICTED: gamma-tubulin complex component 3 [Nicotiana sylvestris] Length = 907 Score = 89.0 bits (219), Expect = 4e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQLRP T G L Sbjct: 856 IDAIGKDYATIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQLRPITRGNL 906 >ref|XP_019165843.1| PREDICTED: gamma-tubulin complex component 3 isoform X1 [Ipomoea nil] Length = 931 Score = 89.0 bits (219), Expect = 4e-18 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI KEYSS+FEGFISQLP+QQH+DLKFLMFRLDFTEFYS LR + G KL Sbjct: 880 IDAITKEYSSLFEGFISQLPVQQHIDLKFLMFRLDFTEFYSHLRGNIGEKL 930 >emb|CDP10165.1| unnamed protein product [Coffea canephora] Length = 944 Score = 89.0 bits (219), Expect = 4e-18 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKLL 157 +DAIA EY+SVF+GFISQLP+QQH+DLKFLMFRLDFTEFYS L+ TG KLL Sbjct: 892 LDAIANEYTSVFDGFISQLPVQQHIDLKFLMFRLDFTEFYSHLQSKTGTKLL 943 >ref|XP_016505980.1| PREDICTED: gamma-tubulin complex component 3-like [Nicotiana tabacum] Length = 443 Score = 87.0 bits (214), Expect = 1e-17 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQL P T G L Sbjct: 392 IDAIGKDYATIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQLHPITRGNL 442 >ref|XP_009605602.1| PREDICTED: gamma-tubulin complex component 3 [Nicotiana tomentosiformis] Length = 907 Score = 87.0 bits (214), Expect = 2e-17 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 IDAI K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQL P T G L Sbjct: 856 IDAIGKDYATIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQLHPITRGNL 906 >ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3 [Solanum tuberosum] Length = 935 Score = 87.0 bits (214), Expect = 2e-17 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 +D I K+Y+S+FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQ++P T GKL Sbjct: 884 MDVIGKDYTSIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQIQPITRGKL 934 >gb|PHU06369.1| Gamma-tubulin complex component 3 [Capsicum chinense] Length = 915 Score = 86.3 bits (212), Expect = 3e-17 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 ID I K+Y+++FEGFIS+LP+QQH+DLKFLMFRL+FTEFYSQL+P T GKL Sbjct: 864 IDVIGKDYTTIFEGFISKLPVQQHIDLKFLMFRLNFTEFYSQLQPITRGKL 914 >gb|PHT71686.1| Gamma-tubulin complex component 3 [Capsicum annuum] Length = 915 Score = 86.3 bits (212), Expect = 3e-17 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 ID I K+Y+++FEGFIS+LP+QQH+DLKFLMFRL+FTEFYSQL+P T GKL Sbjct: 864 IDVIGKDYTTIFEGFISKLPVQQHIDLKFLMFRLNFTEFYSQLQPITRGKL 914 >ref|XP_010325937.1| PREDICTED: gamma-tubulin complex component 3 [Solanum lycopersicum] Length = 935 Score = 86.3 bits (212), Expect = 3e-17 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 +D I K+Y+++FEGFISQLP+QQHVDLKFLMFRL+FTEFYSQ++P T GKL Sbjct: 884 MDVIGKDYTTIFEGFISQLPVQQHVDLKFLMFRLNFTEFYSQIQPITRGKL 934 >ref|XP_016541058.1| PREDICTED: gamma-tubulin complex component 3, partial [Capsicum annuum] Length = 937 Score = 86.3 bits (212), Expect = 3e-17 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 ID I K+Y+++FEGFIS+LP+QQH+DLKFLMFRL+FTEFYSQL+P T GKL Sbjct: 886 IDVIGKDYTTIFEGFISKLPVQQHIDLKFLMFRLNFTEFYSQLQPITRGKL 936 >ref|XP_015086188.1| PREDICTED: gamma-tubulin complex component 3 [Solanum pennellii] Length = 935 Score = 85.9 bits (211), Expect = 5e-17 Identities = 37/51 (72%), Positives = 47/51 (92%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 154 +D I K+Y+++FEGFISQLP+QQH+DLKFLMFRL+FTEFYSQ++P T GKL Sbjct: 884 MDVIGKDYTTIFEGFISQLPVQQHIDLKFLMFRLNFTEFYSQIQPITRGKL 934 >ref|XP_024190792.1| gamma-tubulin complex component 3 [Rosa chinensis] ref|XP_024190793.1| gamma-tubulin complex component 3 [Rosa chinensis] ref|XP_024190794.1| gamma-tubulin complex component 3 [Rosa chinensis] gb|PRQ44437.1| putative gamma-tubulin complex component protein [Rosa chinensis] Length = 855 Score = 85.1 bits (209), Expect = 8e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLRPST 142 +DA+AKEYSS+ E FIS+LP+QQHVDLKFL+FRLDFTEFYSQLRPST Sbjct: 809 LDAVAKEYSSLLEDFISKLPMQQHVDLKFLLFRLDFTEFYSQLRPST 855 >gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] Length = 878 Score = 84.7 bits (208), Expect = 1e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 IDAIAKEYSSVFEGFISQLPIQQHVDLKFLMFRLDFTEFYSQLR 133 +D I+KEYSSVFEGFISQLP+QQH+DLKFLMFRLDFTEFYSQLR Sbjct: 831 MDDISKEYSSVFEGFISQLPVQQHIDLKFLMFRLDFTEFYSQLR 874