BLASTX nr result
ID: Rehmannia31_contig00028752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028752 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179... 54 3e-06 >ref|XP_019184983.1| PREDICTED: uncharacterized protein LOC109179963 [Ipomoea nil] Length = 156 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = -2 Query: 162 KVGSFWICARVVSISE--DWWYLACTHCGKKMHPAVDNFYCVKFDDLFQTG 16 +VGS+W+ A ++ I DWWYL+C C K+ A + FYC KFD+ + G Sbjct: 76 EVGSYWVLATILPIQTIGDWWYLSCKRCPIKLEQASNCFYCDKFDNSYPDG 126