BLASTX nr result
ID: Rehmannia31_contig00028686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028686 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14016.1| hypothetical protein CDL12_13363 [Handroanthus im... 117 2e-28 ref|XP_011089644.1| pentatricopeptide repeat-containing protein ... 111 2e-26 ref|XP_012833555.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-25 ref|XP_015892282.1| PREDICTED: pentatricopeptide repeat-containi... 109 1e-25 ref|XP_022875235.1| pentatricopeptide repeat-containing protein ... 108 3e-25 ref|XP_021655305.1| pentatricopeptide repeat-containing protein ... 107 7e-25 ref|XP_012085223.1| pentatricopeptide repeat-containing protein ... 107 9e-25 ref|XP_024157614.1| pentatricopeptide repeat-containing protein ... 107 1e-24 ref|XP_021633620.1| pentatricopeptide repeat-containing protein ... 106 2e-24 ref|XP_019223814.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-24 ref|XP_016432617.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-24 ref|XP_009773350.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-24 ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containi... 105 3e-24 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 105 3e-24 ref|XP_022157635.1| pentatricopeptide repeat-containing protein ... 105 5e-24 ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-24 emb|CDP03932.1| unnamed protein product [Coffea canephora] 104 9e-24 ref|XP_009599094.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-23 ref|XP_004293124.2| PREDICTED: pentatricopeptide repeat-containi... 103 2e-23 ref|XP_016436251.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-23 >gb|PIN14016.1| hypothetical protein CDL12_13363 [Handroanthus impetiginosus] Length = 378 Score = 117 bits (292), Expect = 2e-28 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFETWLQ LKPGF SDVDEALR+QSDPDLALDIFRWTAQQRHYKHNH+TYLTMIE Sbjct: 57 EKQFETWLQALKPGFNPSDVDEALRSQSDPDLALDIFRWTAQQRHYKHNHITYLTMIE 114 >ref|XP_011089644.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Sesamum indicum] Length = 375 Score = 111 bits (278), Expect = 2e-26 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQF+TWLQ LKPGFT+SDV +ALR+Q DPDLALDIFRWTAQQRHYKHNHLTYL+MIE Sbjct: 54 EKQFDTWLQALKPGFTQSDVVDALRSQPDPDLALDIFRWTAQQRHYKHNHLTYLSMIE 111 >ref|XP_012833555.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Erythranthe guttata] gb|EYU40638.1| hypothetical protein MIMGU_mgv1a007674mg [Erythranthe guttata] Length = 399 Score = 109 bits (273), Expect = 1e-25 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFETWLQ LKPGFT+ DVDEALRAQ DPD+ALDIFRWTAQQR+YKH +LTYLTMIE Sbjct: 78 EKQFETWLQALKPGFTQPDVDEALRAQPDPDVALDIFRWTAQQRYYKHGNLTYLTMIE 135 >ref|XP_015892282.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Ziziphus jujuba] Length = 403 Score = 109 bits (273), Expect = 1e-25 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFETW+Q LKPGF+ +VDEALRAQSDPDLALDIFRWTAQQR+YKHNHLTYLTMI Sbjct: 83 EKQFETWVQNLKPGFSPIEVDEALRAQSDPDLALDIFRWTAQQRNYKHNHLTYLTMI 139 >ref|XP_022875235.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Olea europaea var. sylvestris] Length = 383 Score = 108 bits (270), Expect = 3e-25 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFE+WLQ LK GFT DVD+ALRAQSDPDLALDIFRWTAQQR+YKH HLTYLTMIE Sbjct: 62 EKQFESWLQNLKSGFTSLDVDQALRAQSDPDLALDIFRWTAQQRYYKHTHLTYLTMIE 119 >ref|XP_021655305.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Hevea brasiliensis] Length = 395 Score = 107 bits (268), Expect = 7e-25 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 E QFETW Q LKPGFT +DVD ALRAQSDPDLALDIFRWTAQQR+YKHNH+TYLTMI+ Sbjct: 75 ETQFETWTQNLKPGFTPTDVDAALRAQSDPDLALDIFRWTAQQRNYKHNHVTYLTMIK 132 >ref|XP_012085223.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Jatropha curcas] gb|KDP45277.1| hypothetical protein JCGZ_15142 [Jatropha curcas] Length = 385 Score = 107 bits (267), Expect = 9e-25 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 E QFETW Q LKPGFT SDV ALRAQSDPDLALDIFRWTAQQR+YKHNHLTYLTMI+ Sbjct: 65 ETQFETWTQNLKPGFTPSDVHAALRAQSDPDLALDIFRWTAQQRNYKHNHLTYLTMIK 122 >ref|XP_024157614.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Rosa chinensis] gb|PRQ32440.1| putative pentatricopeptide [Rosa chinensis] Length = 390 Score = 107 bits (266), Expect = 1e-24 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFETW+Q LKPGF DVDEAL+AQSDPDLALDIFRWTAQQR+YKHNH TYLTMI+ Sbjct: 70 EKQFETWVQKLKPGFGPPDVDEALKAQSDPDLALDIFRWTAQQRNYKHNHSTYLTMIK 127 >ref|XP_021633620.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Manihot esculenta] gb|OAY32870.1| hypothetical protein MANES_13G051900 [Manihot esculenta] Length = 397 Score = 106 bits (265), Expect = 2e-24 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 E QFETW + LKPGFT +DVD ALRAQSDPDLALDIFRWTAQQR+YKHNH+TYLTMI+ Sbjct: 77 ETQFETWTENLKPGFTPTDVDAALRAQSDPDLALDIFRWTAQQRNYKHNHVTYLTMIK 134 >ref|XP_019223814.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Nicotiana attenuata] gb|OIT33783.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 380 Score = 106 bits (264), Expect = 2e-24 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFE+W+ LKPGFT +DV+EALRAQSDPDLALDIFRWT QQR+YKHNH+TYLTMI Sbjct: 60 EKQFESWINNLKPGFTPADVNEALRAQSDPDLALDIFRWTGQQRNYKHNHVTYLTMI 116 >ref|XP_016432617.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Nicotiana tabacum] Length = 380 Score = 106 bits (264), Expect = 2e-24 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFE+W+ LKPGFT +DV+EALRAQSDPDLALDIFRWT QQR+YKHNH+TYLTMI Sbjct: 60 EKQFESWINNLKPGFTPADVNEALRAQSDPDLALDIFRWTGQQRNYKHNHVTYLTMI 116 >ref|XP_009773350.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Nicotiana sylvestris] Length = 380 Score = 106 bits (264), Expect = 2e-24 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFE+W+ LKPGFT +DV+EALRAQSDPDLALDIFRWT QQR+YKHNH+TYLTMI Sbjct: 60 EKQFESWINNLKPGFTPADVNEALRAQSDPDLALDIFRWTGQQRNYKHNHVTYLTMI 116 >ref|XP_011024593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Populus euphratica] Length = 387 Score = 105 bits (263), Expect = 3e-24 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 E QFETW Q LKPGFT +DVD A+RAQSDPDLALDIFRWTAQQR+YKHNH+TYLT+I+ Sbjct: 67 ETQFETWTQNLKPGFTPTDVDTAIRAQSDPDLALDIFRWTAQQRNYKHNHMTYLTVIK 124 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gb|PNT51549.1| hypothetical protein POPTR_002G248100v3 [Populus trichocarpa] Length = 387 Score = 105 bits (263), Expect = 3e-24 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 E QFETW Q LKPGFT +DVD A+RAQSDPDLALDIFRWTAQQR+YKHNH+TYLT+I+ Sbjct: 67 ETQFETWTQNLKPGFTPTDVDTAIRAQSDPDLALDIFRWTAQQRNYKHNHITYLTVIK 124 >ref|XP_022157635.1| pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Momordica charantia] Length = 391 Score = 105 bits (262), Expect = 5e-24 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFE+W+Q LKPGF+ SDVDEALRAQSDPDLALD+FRWTAQQR YKHN LTYLT+I+ Sbjct: 71 EKQFESWVQKLKPGFSHSDVDEALRAQSDPDLALDLFRWTAQQRGYKHNDLTYLTIIK 128 >ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Cucumis sativus] gb|KGN58385.1| hypothetical protein Csa_3G635360 [Cucumis sativus] Length = 393 Score = 105 bits (261), Expect = 7e-24 Identities = 47/58 (81%), Positives = 55/58 (94%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFE+W+Q LKPGF+ SDV+EAL+AQSDPDLALD+FRWTAQQR YKHNHLTYLT+I+ Sbjct: 73 EKQFESWVQKLKPGFSPSDVNEALQAQSDPDLALDLFRWTAQQRGYKHNHLTYLTIIK 130 >emb|CDP03932.1| unnamed protein product [Coffea canephora] Length = 384 Score = 104 bits (260), Expect = 9e-24 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFE W+Q LKPGFT SDVDEAL AQ+DPDLALDIFRWTAQQR YKH+ +TYLTMIE Sbjct: 62 EKQFEKWIQNLKPGFTPSDVDEALNAQTDPDLALDIFRWTAQQRGYKHDQVTYLTMIE 119 >ref|XP_009599094.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Nicotiana tomentosiformis] Length = 381 Score = 103 bits (258), Expect = 2e-23 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFE+W+ LKPGF +DV+EALRAQSDPDLALDIFRWT QQR+YKHNH+TYLTMI Sbjct: 61 EKQFESWINNLKPGFKPADVNEALRAQSDPDLALDIFRWTGQQRNYKHNHVTYLTMI 117 >ref|XP_004293124.2| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial [Fragaria vesca subsp. vesca] Length = 373 Score = 103 bits (257), Expect = 2e-23 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMIE 444 EKQFETW+ LKPGF DVDEAL+AQSDPDLALDIFRWTAQQR+YKH+H TYLTMI+ Sbjct: 53 EKQFETWIHKLKPGFGPPDVDEALKAQSDPDLALDIFRWTAQQRNYKHSHSTYLTMIK 110 >ref|XP_016436251.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Nicotiana tabacum] Length = 411 Score = 103 bits (258), Expect = 2e-23 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +1 Query: 271 EKQFETWLQTLKPGFTESDVDEALRAQSDPDLALDIFRWTAQQRHYKHNHLTYLTMI 441 EKQFE+W+ LKPGF +DV+EALRAQSDPDLALDIFRWT QQR+YKHNH+TYLTMI Sbjct: 91 EKQFESWINNLKPGFKPADVNEALRAQSDPDLALDIFRWTGQQRNYKHNHVTYLTMI 147