BLASTX nr result
ID: Rehmannia31_contig00028627
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028627 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV36286.1| hypothetical protein F511_14304 [Dorcoceras hygro... 69 2e-10 gb|ONM39062.1| DNA repair helicase XPB1 [Zea mays] 67 6e-10 gb|KRH59944.1| hypothetical protein GLYMA_05G209700 [Glycine max] 67 6e-10 gb|OEL33778.1| DNA repair helicase XPB2, partial [Dichanthelium ... 67 7e-10 ref|XP_022684073.1| DNA repair helicase XPB2 isoform X2 [Setaria... 67 8e-10 gb|ONM39055.1| DNA repair helicase XPB1 [Zea mays] 67 8e-10 gb|KQK97107.1| hypothetical protein SETIT_009434mg [Setaria ital... 67 8e-10 gb|ONM39060.1| DNA repair helicase XPB1 [Zea mays] 67 8e-10 gb|ONM39072.1| DNA repair helicase XPB1 [Zea mays] 67 8e-10 ref|XP_020179288.1| DNA repair helicase XPB1-like [Aegilops taus... 67 8e-10 gb|EMS50047.1| DNA repair helicase XPB2 [Triticum urartu] 67 8e-10 dbj|BAJ96793.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 8e-10 emb|CDM83688.1| unnamed protein product [Triticum aestivum] 67 8e-10 ref|XP_004975516.1| DNA repair helicase XPB1 isoform X1 [Setaria... 67 8e-10 gb|PAN29056.1| hypothetical protein PAHAL_E02048 [Panicum hallii] 67 8e-10 ref|XP_003569596.1| PREDICTED: DNA repair helicase XPB1-like [Br... 67 8e-10 ref|XP_008675159.1| DNA repair helicase XPB1 [Zea mays] >gi|1142... 67 8e-10 ref|XP_002456182.1| DNA repair helicase XPB1 isoform X2 [Sorghum... 67 8e-10 ref|XP_021312622.1| DNA repair helicase XPB1 isoform X1 [Sorghum... 67 8e-10 gb|KQK97106.1| hypothetical protein SETIT_009434mg [Setaria ital... 66 1e-09 >gb|KZV36286.1| hypothetical protein F511_14304 [Dorcoceras hygrometricum] Length = 793 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGW 95 VQCAEVWCPMTKEFFAEYLKKENSKKKQ W Sbjct: 488 VQCAEVWCPMTKEFFAEYLKKENSKKKQASW 518 >gb|ONM39062.1| DNA repair helicase XPB1 [Zea mays] Length = 335 Score = 66.6 bits (161), Expect = 6e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 253 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 284 >gb|KRH59944.1| hypothetical protein GLYMA_05G209700 [Glycine max] Length = 689 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVG 92 VQCAEVWCPMTKEFFAEYLKKENSKK+QVG Sbjct: 470 VQCAEVWCPMTKEFFAEYLKKENSKKRQVG 499 >gb|OEL33778.1| DNA repair helicase XPB2, partial [Dichanthelium oligosanthes] Length = 452 Score = 66.6 bits (161), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 159 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 190 >ref|XP_022684073.1| DNA repair helicase XPB2 isoform X2 [Setaria italica] Length = 661 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 369 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 400 >gb|ONM39055.1| DNA repair helicase XPB1 [Zea mays] Length = 673 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >gb|KQK97107.1| hypothetical protein SETIT_009434mg [Setaria italica] Length = 701 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 473 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 504 >gb|ONM39060.1| DNA repair helicase XPB1 [Zea mays] Length = 715 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >gb|ONM39072.1| DNA repair helicase XPB1 [Zea mays] Length = 739 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >ref|XP_020179288.1| DNA repair helicase XPB1-like [Aegilops tauschii subsp. tauschii] Length = 759 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 468 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 499 >gb|EMS50047.1| DNA repair helicase XPB2 [Triticum urartu] Length = 762 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 455 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 486 >dbj|BAJ96793.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 762 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 473 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 504 >emb|CDM83688.1| unnamed protein product [Triticum aestivum] Length = 765 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >ref|XP_004975516.1| DNA repair helicase XPB1 isoform X1 [Setaria italica] gb|KQK97108.1| hypothetical protein SETIT_009434mg [Setaria italica] Length = 765 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 473 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 504 >gb|PAN29056.1| hypothetical protein PAHAL_E02048 [Panicum hallii] Length = 766 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 473 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 504 >ref|XP_003569596.1| PREDICTED: DNA repair helicase XPB1-like [Brachypodium distachyon] gb|KQK09270.1| hypothetical protein BRADI_2g47090v3 [Brachypodium distachyon] Length = 766 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >ref|XP_008675159.1| DNA repair helicase XPB1 [Zea mays] gb|ONM39064.1| DNA repair helicase XPB1 [Zea mays] Length = 767 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >ref|XP_002456182.1| DNA repair helicase XPB1 isoform X2 [Sorghum bicolor] gb|EES01302.1| hypothetical protein SORBI_3003G264100 [Sorghum bicolor] Length = 767 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >ref|XP_021312622.1| DNA repair helicase XPB1 isoform X1 [Sorghum bicolor] Length = 792 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQVGWV 98 VQCAEVWCPMTKEFFAEYLKKENSKKKQV +V Sbjct: 474 VQCAEVWCPMTKEFFAEYLKKENSKKKQVLYV 505 >gb|KQK97106.1| hypothetical protein SETIT_009434mg [Setaria italica] Length = 504 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VQCAEVWCPMTKEFFAEYLKKENSKKKQV 89 VQCAEVWCPMTKEFFAEYLKKENSKKKQV Sbjct: 473 VQCAEVWCPMTKEFFAEYLKKENSKKKQV 501