BLASTX nr result
ID: Rehmannia31_contig00028541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028541 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843142.1| PREDICTED: F-box protein CPR30-like [Erythra... 67 2e-10 gb|EYU32694.1| hypothetical protein MIMGU_mgv1a009361mg [Erythra... 65 7e-10 ref|XP_012843144.1| PREDICTED: uncharacterized protein LOC105963... 65 7e-10 gb|EYU32691.1| hypothetical protein MIMGU_mgv1a026894mg, partial... 55 2e-06 ref|XP_012843143.1| PREDICTED: F-box protein CPR30-like [Erythra... 55 2e-06 >ref|XP_012843142.1| PREDICTED: F-box protein CPR30-like [Erythranthe guttata] gb|EYU32690.1| hypothetical protein MIMGU_mgv1a018342mg [Erythranthe guttata] Length = 382 Score = 66.6 bits (161), Expect = 2e-10 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +3 Query: 120 IVGFCDGLICLMNRGNRNIVILNPSTEDYWRLGAAK----YCSDWSHSWFGHHPCTGDYT 287 I+G CDGLICL + G+R + NPST Y LG A C SWFG HPCTG+Y Sbjct: 118 ILGSCDGLICLYDEGHRKFAVFNPSTRKY-DLGLADKFRWLCLSNYASWFGRHPCTGEYV 176 Query: 288 LFLGS 302 L +GS Sbjct: 177 LVIGS 181 >gb|EYU32694.1| hypothetical protein MIMGU_mgv1a009361mg [Erythranthe guttata] Length = 344 Score = 65.1 bits (157), Expect = 7e-10 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 120 IVGFCDGLICLMNRGNRNIVILNPSTEDYWRLGAAKYC-SDW--SHSWFGHHPCTGDYTL 290 I+G CDGLICL+++ + + + NPST +Y + A ++ W SWFG HPCTG+Y L Sbjct: 102 ILGSCDGLICLVDKDIKKVSVFNPSTREYQKREAKRFLWLSWFKKVSWFGRHPCTGEYVL 161 Query: 291 FLGS 302 +GS Sbjct: 162 VVGS 165 >ref|XP_012843144.1| PREDICTED: uncharacterized protein LOC105963297 [Erythranthe guttata] Length = 378 Score = 65.1 bits (157), Expect = 7e-10 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 120 IVGFCDGLICLMNRGNRNIVILNPSTEDYWRLGAAKYC-SDW--SHSWFGHHPCTGDYTL 290 I+G CDGLICL+++ + + + NPST +Y + A ++ W SWFG HPCTG+Y L Sbjct: 102 ILGSCDGLICLVDKDIKKVSVFNPSTREYQKREAKRFLWLSWFKKVSWFGRHPCTGEYVL 161 Query: 291 FLGS 302 +GS Sbjct: 162 VVGS 165 >gb|EYU32691.1| hypothetical protein MIMGU_mgv1a026894mg, partial [Erythranthe guttata] Length = 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Frame = +3 Query: 120 IVGFCDGLICLMNRGNRNIVILNPSTEDYWRLGAAKYCSDWSH-----SWFGHHPCTGDY 284 I+G CDGLICL N+ + NPS Y A K+ W SWFG +PCTG+Y Sbjct: 119 ILGSCDGLICLYEGANQRFSVFNPSMNRYELRLADKF--RWLFLTNYASWFGRNPCTGEY 176 Query: 285 TLFLGS 302 L +GS Sbjct: 177 VLVIGS 182 >ref|XP_012843143.1| PREDICTED: F-box protein CPR30-like [Erythranthe guttata] Length = 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Frame = +3 Query: 120 IVGFCDGLICLMNRGNRNIVILNPSTEDYWRLGAAKYCSDWSH-----SWFGHHPCTGDY 284 I+G CDGLICL N+ + NPS Y A K+ W SWFG +PCTG+Y Sbjct: 119 ILGSCDGLICLYEGANQRFSVFNPSMNRYELRLADKF--RWLFLTNYASWFGRNPCTGEY 176 Query: 285 TLFLGS 302 L +GS Sbjct: 177 VLVIGS 182