BLASTX nr result
ID: Rehmannia31_contig00028522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028522 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069702.1| cytochrome b561, DM13 and DOMON domain-conta... 85 1e-16 gb|PIN24012.1| DM13, DoH, and DOMON domain protein [Handroanthus... 81 2e-15 ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 76 2e-13 ref|XP_022892673.1| cytochrome b561, DM13 and DOMON domain-conta... 63 6e-09 gb|PLY84063.1| hypothetical protein LSAT_6X114661 [Lactuca sativa] 62 2e-08 ref|XP_023765643.1| cytochrome b561, DM13 and DOMON domain-conta... 62 2e-08 emb|CDP00314.1| unnamed protein product [Coffea canephora] 59 1e-07 gb|PON99209.1| Cytochrome b561 and DOMON domain-containing prote... 59 2e-07 gb|PON74581.1| Cytochrome b561 and DOMON domain-containing prote... 59 3e-07 ref|XP_015080218.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 58 4e-07 ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 58 4e-07 ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 58 5e-07 ref|XP_022028464.1| cytochrome b561, DM13 and DOMON domain-conta... 57 7e-07 ref|XP_016508235.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 7e-07 ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 7e-07 ref|XP_019247906.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 56 2e-06 ref|XP_010665962.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 52 2e-06 gb|KMT19028.1| hypothetical protein BVRB_2g031230 [Beta vulgaris... 52 2e-06 ref|XP_016574940.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b... 56 2e-06 gb|PHU14851.1| Cytochrome, and DOMON domain-containing protein [... 56 2e-06 >ref|XP_011069702.1| cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Sesamum indicum] Length = 883 Score = 85.1 bits (209), Expect = 1e-16 Identities = 45/82 (54%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQPTMFEN 268 +KN T + L KN+T QIKV+AV DIP AS+FGHILL EQPTMF+N Sbjct: 101 YKNDTFVVHLHKNVTWDQIKVVAVWDIPTASDFGHILLTNYSANGGVNLSNNEQPTMFDN 160 Query: 269 CKVLCDNNWIKWNFKEGENVIN 334 CK+L DN I+W+FKEG+NVI+ Sbjct: 161 CKMLSDNYRIRWSFKEGDNVID 182 >gb|PIN24012.1| DM13, DoH, and DOMON domain protein [Handroanthus impetiginosus] Length = 884 Score = 81.3 bits (199), Expect(2) = 2e-15 Identities = 44/82 (53%), Positives = 54/82 (65%), Gaps = 2/82 (2%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQPTMFEN 268 +KN + + L KN+T QIKVLAV DIP AS+FGHI L EQPT+F+N Sbjct: 101 YKNDSFIVHLRKNVTWDQIKVLAVWDIPTASDFGHIFLGNDSVNGGASFPSIEQPTVFQN 160 Query: 269 CKVLCDNNWIKWNFKEGENVIN 334 CKVL DN I+W+FKE ENVI+ Sbjct: 161 CKVLSDNYRIRWSFKEAENVID 182 Score = 28.5 bits (62), Expect(2) = 2e-15 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +1 Query: 22 AAGDDFQLPSITNSFLISNLNLIQI*KYYNFIV 120 AAGDDF ++TN F+IS+ L Q K +FIV Sbjct: 78 AAGDDFH--NLTNGFIISDSALNQTYKNDSFIV 108 >ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Erythranthe guttata] gb|EYU32377.1| hypothetical protein MIMGU_mgv1a001118mg [Erythranthe guttata] Length = 883 Score = 76.3 bits (186), Expect = 2e-13 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQPTMFEN 268 ++N T + L KN+T QIKVLAV D+P ASNFGHILL EQPT+FEN Sbjct: 101 YQNDTFIVPLRKNVTWDQIKVLAVWDVPTASNFGHILLSNYSVNGGANFSDREQPTVFEN 160 Query: 269 CKVLCDNNWIKWNFKEGENVIN 334 CKVL DN I+W+ E + VI+ Sbjct: 161 CKVLSDNYRIRWSLNEEDAVID 182 >ref|XP_022892673.1| cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Olea europaea var. sylvestris] Length = 894 Score = 63.2 bits (152), Expect = 6e-09 Identities = 41/94 (43%), Positives = 50/94 (53%), Gaps = 14/94 (14%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXX--------- 241 +KN + L L KN+T +I+VLAV D P AS+FGH+LL Sbjct: 100 YKNDSFLVNLRKNVTWDKIEVLAVWDTPTASDFGHVLLRNLSNGIENSAPLPMPVNGSTS 159 Query: 242 ---TEQPTMFENCKVLCDNNWIKWNFKEGENVIN 334 EQPTMFENCKVL D I+W KE EN I+ Sbjct: 160 LMGNEQPTMFENCKVLNDGYRIRWTLKEEENRID 193 >gb|PLY84063.1| hypothetical protein LSAT_6X114661 [Lactuca sativa] Length = 861 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 6/86 (6%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXT----EQPT 256 +KN T + L KNIT QI+V++V D +S+FGH+LL + ++PT Sbjct: 61 YKNDTFIVNLMKNITWDQIRVVSVWDTSMSSDFGHVLLQNSEEIPPDPSNSSLEIHQEPT 120 Query: 257 MFENCKVLCDNNWIKWNFKEGENVIN 334 MFENCKVL D ++W +E +NVI+ Sbjct: 121 MFENCKVLSDTYRLRWTLREDKNVID 146 >ref|XP_023765643.1| cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Lactuca sativa] Length = 908 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 6/86 (6%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXT----EQPT 256 +KN T + L KNIT QI+V++V D +S+FGH+LL + ++PT Sbjct: 108 YKNDTFIVNLMKNITWDQIRVVSVWDTSMSSDFGHVLLQNSEEIPPDPSNSSLEIHQEPT 167 Query: 257 MFENCKVLCDNNWIKWNFKEGENVIN 334 MFENCKVL D ++W +E +NVI+ Sbjct: 168 MFENCKVLSDTYRLRWTLREDKNVID 193 >emb|CDP00314.1| unnamed protein product [Coffea canephora] Length = 844 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 3/94 (3%) Frame = +2 Query: 62 VSSFPI*TLFRFKNTTTLLWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXX 241 +S + ++ + T L KN+T QIKVL+V D+P AS+FGH++L Sbjct: 51 ISDHKLNQTYKNDSFTVNLLKNVTWDQIKVLSVWDLPTASDFGHVVL--GGNSSSTNFNG 108 Query: 242 TEQP---TMFENCKVLCDNNWIKWNFKEGENVIN 334 T P TMF+NCKVL N ++WN+ E ++ I+ Sbjct: 109 TGGPLTVTMFDNCKVLSKNYRVRWNYSEDKDFID 142 >gb|PON99209.1| Cytochrome b561 and DOMON domain-containing protein [Trema orientalis] Length = 855 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/91 (39%), Positives = 48/91 (52%), Gaps = 11/91 (12%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE------- 247 +KN+T + L KN+T I+VLAV D P ASNFGH++L Sbjct: 59 YKNSTFVVHLGKNVTWDGIRVLAVWDRPTASNFGHVVLKNVSNGSTTGPPGGSGAGSVRG 118 Query: 248 --QPTMFENCKVLCDNNWIKWNFKEGENVIN 334 +PTM ENCKVL +N ++W ENVI+ Sbjct: 119 QVEPTMLENCKVLSENYRVRWTLNADENVID 149 >gb|PON74581.1| Cytochrome b561 and DOMON domain-containing protein [Parasponia andersonii] Length = 855 Score = 58.5 bits (140), Expect = 3e-07 Identities = 36/91 (39%), Positives = 48/91 (52%), Gaps = 11/91 (12%) Frame = +2 Query: 95 FKNTTTL--LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE------- 247 +KN+T + L KN+T I+VLAV D P ASNFGH++L Sbjct: 59 YKNSTFVVHLGKNVTWNGIQVLAVWDRPTASNFGHVVLKNVSDGSTTGPPGGSGAGSVRG 118 Query: 248 --QPTMFENCKVLCDNNWIKWNFKEGENVIN 334 +PTM ENCKVL +N ++W ENVI+ Sbjct: 119 QVEPTMLENCKVLSENYRVRWTLNADENVID 149 >ref|XP_015080218.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum pennellii] Length = 901 Score = 58.2 bits (139), Expect = 4e-07 Identities = 33/83 (39%), Positives = 42/83 (50%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE-----------QPTMF 262 L KN+T I VLAV D+P AS+FGH++L PTMF Sbjct: 117 LMKNVTWDDINVLAVWDLPMASDFGHVVLRNLTNGTEFLAPLPSLVNGTVIKGNGMPTMF 176 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W+ E E+VI Sbjct: 177 NNCKVLADNYRVRWSLNEEEDVI 199 >ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum lycopersicum] Length = 901 Score = 58.2 bits (139), Expect = 4e-07 Identities = 33/83 (39%), Positives = 42/83 (50%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE-----------QPTMF 262 L KN+T I VLAV D+P AS+FGH++L PTMF Sbjct: 117 LMKNVTWDDINVLAVWDLPMASDFGHVVLRNLTNGTEFLAPLPSLVNGTVIKGNGMPTMF 176 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W+ E E+VI Sbjct: 177 NNCKVLADNYRVRWSLNEEEDVI 199 >ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana sylvestris] ref|XP_016468217.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Nicotiana tabacum] Length = 900 Score = 57.8 bits (138), Expect = 5e-07 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 11/110 (10%) Frame = +2 Query: 35 ISNFQVSPTVSSFPI*TLFRFKNTTTLLWKNITRIQIKVLAV*DIPRASNFGHILLXXXX 214 + N +S + ++ L KN+T I VLAV D+P AS+FGH++L Sbjct: 90 LENLTKGFVISELKLNKTYKSDGFVVKLMKNVTWDDINVLAVWDLPMASDFGHVVLRNLT 149 Query: 215 XXXXXXXXXTEQ-----------PTMFENCKVLCDNNWIKWNFKEGENVI 331 PTMF NCKVL DN ++W E E+V+ Sbjct: 150 NGTEFLAPLPSSVNGTVIKGNGMPTMFNNCKVLADNYRVRWTLNEEEDVV 199 >ref|XP_022028464.1| cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Helianthus annuus] gb|OTG31428.1| hypothetical protein HannXRQ_Chr03g0075511 [Helianthus annuus] Length = 900 Score = 57.4 bits (137), Expect = 7e-07 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = +2 Query: 83 TLFRFKNTTTLLWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE----- 247 T+++ + L N+T QIKV++V D AS+FGH++L Sbjct: 107 TVYKNHSFVVSLMDNVTWDQIKVVSVWDSLAASDFGHVVLPDLGSESNSGSESNSSVKVD 166 Query: 248 -QPTMFENCKVLCDNNWIKWNFKEGENVIN 334 QPTMFENCKVL D ++W E +NVI+ Sbjct: 167 VQPTMFENCKVLSDTYRLRWTLNEKDNVID 196 >ref|XP_016508235.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Nicotiana tabacum] Length = 900 Score = 57.4 bits (137), Expect = 7e-07 Identities = 32/83 (38%), Positives = 41/83 (49%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQ-----------PTMF 262 L KN+T I VLAV D+P AS+FGH++L PTMF Sbjct: 117 LMKNVTWDDINVLAVWDLPMASDFGHVVLRNLTNGTEFLAPLPSSVNGTVIKGNGMPTMF 176 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W E E+V+ Sbjct: 177 NNCKVLADNYRVRWTLNEEEDVV 199 >ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana tomentosiformis] Length = 901 Score = 57.4 bits (137), Expect = 7e-07 Identities = 32/83 (38%), Positives = 41/83 (49%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQ-----------PTMF 262 L KN+T I VLAV D+P AS+FGH++L PTMF Sbjct: 117 LMKNVTWDDINVLAVWDLPMASDFGHVVLRNLTNGTEFLAPLPSSVNGTVIKGNGMPTMF 176 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W E E+V+ Sbjct: 177 NNCKVLADNYRVRWTLNEEEDVV 199 >ref|XP_019247906.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana attenuata] gb|OIT02583.1| cytochrome b561, dm13 and domon domain-containing protein [Nicotiana attenuata] Length = 900 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTEQ-----------PTMF 262 L KN+T I VLAV D+P AS+FGH++L PTMF Sbjct: 117 LMKNVTWDDINVLAVWDLPMASDFGHVVLRNLTNGTEFLAPLPSSVNGTVIKGNGMPTMF 176 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W E ++V+ Sbjct: 177 NNCKVLADNYRVRWTLNEEDDVV 199 >ref|XP_010665962.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Beta vulgaris subsp. vulgaris] Length = 908 Score = 52.4 bits (124), Expect(3) = 2e-06 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 18/91 (19%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXT----------------- 244 L NI+ QI+V+AV D P AS+FGH++L Sbjct: 117 LRSNISWDQIQVVAVWDSPTASDFGHVVLPNLVNGSEISAPSPAPESDSSSNATNVKRLH 176 Query: 245 -EQPTMFENCKVLCDNNWIKWNFKEGENVIN 334 E+PTMFENCKVL ++W +E EN+I+ Sbjct: 177 HEEPTMFENCKVLSSKYRVRWTLREEENLID 207 Score = 25.4 bits (54), Expect(3) = 2e-06 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 22 AAGDDFQLPSITNSFLISNLNLIQI*KYYNFIV 120 A GD+F ++TN F+IS+ NL + K +F+V Sbjct: 85 AVGDNFV--NLTNGFIISDENLSRAYKNDSFVV 115 Score = 20.4 bits (41), Expect(3) = 2e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 315 REKM*LIIIDLEAATGI 365 RE+ LI I LEA TGI Sbjct: 200 REEENLIDIGLEAVTGI 216 >gb|KMT19028.1| hypothetical protein BVRB_2g031230 [Beta vulgaris subsp. vulgaris] Length = 860 Score = 52.4 bits (124), Expect(3) = 2e-06 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 18/91 (19%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXT----------------- 244 L NI+ QI+V+AV D P AS+FGH++L Sbjct: 69 LRSNISWDQIQVVAVWDSPTASDFGHVVLPNLVNGSEISAPSPAPESDSSSNATNVKRLH 128 Query: 245 -EQPTMFENCKVLCDNNWIKWNFKEGENVIN 334 E+PTMFENCKVL ++W +E EN+I+ Sbjct: 129 HEEPTMFENCKVLSSKYRVRWTLREEENLID 159 Score = 25.4 bits (54), Expect(3) = 2e-06 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 22 AAGDDFQLPSITNSFLISNLNLIQI*KYYNFIV 120 A GD+F ++TN F+IS+ NL + K +F+V Sbjct: 37 AVGDNFV--NLTNGFIISDENLSRAYKNDSFVV 67 Score = 20.4 bits (41), Expect(3) = 2e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 315 REKM*LIIIDLEAATGI 365 RE+ LI I LEA TGI Sbjct: 152 REEENLIDIGLEAVTGI 168 >ref|XP_016574940.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Capsicum annuum] Length = 883 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE-----------QPTMF 262 L N+T + VLAV D+P AS+FGH++L PTMF Sbjct: 113 LMNNVTWDDLNVLAVWDVPMASDFGHVVLRNLTNGTEFLAPLESWINGSVIMGSGMPTMF 172 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W+ E E+VI Sbjct: 173 NNCKVLADNYRVRWSLNEEEDVI 195 >gb|PHU14851.1| Cytochrome, and DOMON domain-containing protein [Capsicum chinense] Length = 896 Score = 55.8 bits (133), Expect = 2e-06 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 11/83 (13%) Frame = +2 Query: 116 LWKNITRIQIKVLAV*DIPRASNFGHILLXXXXXXXXXXXXXTE-----------QPTMF 262 L N+T + VLAV D+P AS+FGH++L PTMF Sbjct: 113 LMNNVTWDDLNVLAVWDVPMASDFGHVVLRNLTNGTEFLAPLESWINGSVIMGSGMPTMF 172 Query: 263 ENCKVLCDNNWIKWNFKEGENVI 331 NCKVL DN ++W+ E E+VI Sbjct: 173 NNCKVLADNYRVRWSLNEEEDVI 195