BLASTX nr result
ID: Rehmannia31_contig00028382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028382 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16688.1| DNA helicase [Handroanthus impetiginosus] 71 3e-11 ref|XP_012828132.1| PREDICTED: DNA-binding protein SMUBP-2 [Eryt... 69 2e-10 ref|XP_011075212.2| DNA-binding protein SMUBP-2 [Sesamum indicum] 65 3e-09 gb|OIV92041.1| hypothetical protein TanjilG_15032 [Lupinus angus... 59 7e-09 gb|AKT44431.1| DNA-binding family protein, partial [Ceriops deca... 60 1e-08 ref|XP_009114163.1| PREDICTED: DNA-binding protein SMUBP-2 [Bras... 63 2e-08 emb|CDY65466.1| BnaA09g53590D [Brassica napus] 63 2e-08 ref|XP_006395725.1| DNA-binding protein SMUBP-2 [Eutrema salsugi... 63 2e-08 ref|XP_018457722.1| PREDICTED: DNA-binding protein SMUBP-2 [Raph... 63 2e-08 gb|OMO70260.1| hypothetical protein COLO4_28666 [Corchorus olito... 63 2e-08 ref|XP_002277619.1| PREDICTED: DNA-binding protein SMUBP-2 [Viti... 63 2e-08 emb|CBI29875.3| unnamed protein product, partial [Vitis vinifera] 63 2e-08 emb|CAN80641.1| hypothetical protein VITISV_016912 [Vitis vinifera] 63 2e-08 ref|XP_024018439.1| DNA-binding protein SMUBP-2 isoform X2 [Moru... 62 3e-08 ref|XP_010091862.1| DNA-binding protein SMUBP-2 isoform X1 [Moru... 62 3e-08 ref|XP_022742961.1| DNA-binding protein SMUBP-2 isoform X4 [Duri... 62 4e-08 ref|XP_022742960.1| DNA-binding protein SMUBP-2 isoform X3 [Duri... 62 4e-08 ref|XP_019187575.1| PREDICTED: DNA-binding protein SMUBP-2 isofo... 62 4e-08 ref|XP_022742959.1| DNA-binding protein SMUBP-2 isoform X2 [Duri... 62 4e-08 ref|XP_022742958.1| DNA-binding protein SMUBP-2 isoform X1 [Duri... 62 4e-08 >gb|PIN16688.1| DNA helicase [Handroanthus impetiginosus] Length = 652 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGDDVMSMLTVQYRMHELIMNWSSEELYHGK+ Sbjct: 436 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKI 467 >ref|XP_012828132.1| PREDICTED: DNA-binding protein SMUBP-2 [Erythranthe guttata] gb|EYU18761.1| hypothetical protein MIMGU_mgv1a002633mg [Erythranthe guttata] Length = 652 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGDDVMSMLTVQYRMHELIMNWSSEELY+GKV Sbjct: 436 YGDDVMSMLTVQYRMHELIMNWSSEELYNGKV 467 >ref|XP_011075212.2| DNA-binding protein SMUBP-2 [Sesamum indicum] Length = 683 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGDDV SMLTVQYRMHELIMNWSSEELY GK+ Sbjct: 467 YGDDVTSMLTVQYRMHELIMNWSSEELYDGKI 498 >gb|OIV92041.1| hypothetical protein TanjilG_15032 [Lupinus angustifolius] Length = 54 Score = 58.9 bits (141), Expect = 7e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+V SMLTVQYRMHELIM+WSS+ELY+ KV Sbjct: 2 YGDEVTSMLTVQYRMHELIMDWSSKELYNSKV 33 >gb|AKT44431.1| DNA-binding family protein, partial [Ceriops decandra] Length = 141 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+V SMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 4 YGDEVTSMLTVQYRMHELIMNWSSKELYNSKI 35 >ref|XP_009114163.1| PREDICTED: DNA-binding protein SMUBP-2 [Brassica rapa] Length = 643 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD++ SMLTVQYRMHELIMNWSSEELY GK+ Sbjct: 427 YGDEIKSMLTVQYRMHELIMNWSSEELYDGKI 458 >emb|CDY65466.1| BnaA09g53590D [Brassica napus] Length = 643 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD++ SMLTVQYRMHELIMNWSSEELY GK+ Sbjct: 427 YGDEIKSMLTVQYRMHELIMNWSSEELYDGKI 458 >ref|XP_006395725.1| DNA-binding protein SMUBP-2 [Eutrema salsugineum] gb|ESQ33010.1| hypothetical protein EUTSA_v10003809mg [Eutrema salsugineum] gb|ESQ33011.1| hypothetical protein EUTSA_v10003809mg [Eutrema salsugineum] Length = 643 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD++ SMLTVQYRMHELIMNWSSEELY GK+ Sbjct: 427 YGDEIKSMLTVQYRMHELIMNWSSEELYDGKI 458 >ref|XP_018457722.1| PREDICTED: DNA-binding protein SMUBP-2 [Raphanus sativus] Length = 644 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD++ SMLTVQYRMHELIMNWSSEELY GK+ Sbjct: 428 YGDEIKSMLTVQYRMHELIMNWSSEELYGGKI 459 >gb|OMO70260.1| hypothetical protein COLO4_28666 [Corchorus olitorius] Length = 646 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 430 YGDEVMSMLTVQYRMHELIMNWSSKELYNSKI 461 >ref|XP_002277619.1| PREDICTED: DNA-binding protein SMUBP-2 [Vitis vinifera] Length = 647 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 431 YGDEVMSMLTVQYRMHELIMNWSSKELYNSKI 462 >emb|CBI29875.3| unnamed protein product, partial [Vitis vinifera] Length = 647 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 431 YGDEVMSMLTVQYRMHELIMNWSSKELYNSKI 462 >emb|CAN80641.1| hypothetical protein VITISV_016912 [Vitis vinifera] Length = 649 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 433 YGDEVMSMLTVQYRMHELIMNWSSKELYNSKI 464 >ref|XP_024018439.1| DNA-binding protein SMUBP-2 isoform X2 [Morus notabilis] Length = 498 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YG+DVMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 282 YGNDVMSMLTVQYRMHELIMNWSSKELYNSKI 313 >ref|XP_010091862.1| DNA-binding protein SMUBP-2 isoform X1 [Morus notabilis] gb|EXB46303.1| DNA-binding protein SMUBP-2 [Morus notabilis] Length = 579 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YG+DVMSMLTVQYRMHELIMNWSS+ELY+ K+ Sbjct: 363 YGNDVMSMLTVQYRMHELIMNWSSKELYNSKI 394 >ref|XP_022742961.1| DNA-binding protein SMUBP-2 isoform X4 [Durio zibethinus] Length = 521 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY K+ Sbjct: 305 YGDEVMSMLTVQYRMHELIMNWSSKELYDSKI 336 >ref|XP_022742960.1| DNA-binding protein SMUBP-2 isoform X3 [Durio zibethinus] Length = 579 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY K+ Sbjct: 363 YGDEVMSMLTVQYRMHELIMNWSSKELYDSKI 394 >ref|XP_019187575.1| PREDICTED: DNA-binding protein SMUBP-2 isoform X2 [Ipomoea nil] Length = 579 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY K+ Sbjct: 363 YGDEVMSMLTVQYRMHELIMNWSSKELYDSKI 394 >ref|XP_022742959.1| DNA-binding protein SMUBP-2 isoform X2 [Durio zibethinus] Length = 588 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY K+ Sbjct: 372 YGDEVMSMLTVQYRMHELIMNWSSKELYDSKI 403 >ref|XP_022742958.1| DNA-binding protein SMUBP-2 isoform X1 [Durio zibethinus] Length = 646 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 485 YGDDVMSMLTVQYRMHELIMNWSSEELYHGKV 390 YGD+VMSMLTVQYRMHELIMNWSS+ELY K+ Sbjct: 430 YGDEVMSMLTVQYRMHELIMNWSSKELYDSKI 461