BLASTX nr result
ID: Rehmannia31_contig00027707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027707 (729 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093124.1| ferric reduction oxidase 2-like [Sesamum ind... 62 3e-09 ref|XP_011092747.1| ferric reduction oxidase 2 isoform X1 [Sesam... 60 4e-09 ref|XP_011092755.1| ferric reduction oxidase 2 isoform X2 [Sesam... 60 4e-09 gb|PIM97205.1| Ferric-chelate reductase (NADH) [Handroanthus imp... 60 5e-09 gb|EYU32154.1| hypothetical protein MIMGU_mgv1a002115mg [Erythra... 60 7e-09 ref|XP_012843765.1| PREDICTED: ferric reduction oxidase 2-like [... 60 7e-09 gb|KZV37824.1| ferric reduction oxidase 2 [Dorcoceras hygrometri... 59 1e-08 gb|EPS59494.1| hypothetical protein M569_15313, partial [Genlise... 58 4e-08 gb|PIN05823.1| Ferric reductase, NADH/NADPH oxidase [Handroanthu... 57 2e-07 emb|CDP08776.1| unnamed protein product [Coffea canephora] 52 8e-07 ref|XP_022895493.1| ferric reduction oxidase 2-like isoform X1 [... 53 8e-07 ref|XP_022895494.1| ferric reduction oxidase 2-like isoform X2 [... 53 8e-07 >ref|XP_011093124.1| ferric reduction oxidase 2-like [Sesamum indicum] Length = 697 Score = 62.4 bits (150), Expect(2) = 3e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWI+MPTDTYYN+ LLHILAHTNSTFFG++G Sbjct: 28 MWIMMPTDTYYNDWLLHILAHTNSTFFGIQG 58 Score = 27.7 bits (60), Expect(2) = 3e-09 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV--CIW 570 F I GP ML+FTF IL I V CI+ Sbjct: 54 FGIQGPIMLDFTFPILLIAVLGCIY 78 >ref|XP_011092747.1| ferric reduction oxidase 2 isoform X1 [Sesamum indicum] Length = 704 Score = 60.1 bits (144), Expect(2) = 4e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ LLHILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYYNDWLLHILADTNSTFFGIQG 58 Score = 29.3 bits (64), Expect(2) = 4e-09 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV 561 F I GP ML+FTF ILFI V Sbjct: 54 FGIQGPIMLDFTFPILFIAV 73 >ref|XP_011092755.1| ferric reduction oxidase 2 isoform X2 [Sesamum indicum] Length = 703 Score = 60.1 bits (144), Expect(2) = 4e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ LLHILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYYNDWLLHILADTNSTFFGIQG 58 Score = 29.3 bits (64), Expect(2) = 4e-09 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV 561 F I GP ML+FTF ILFI V Sbjct: 54 FGIQGPIMLDFTFPILFIAV 73 >gb|PIM97205.1| Ferric-chelate reductase (NADH) [Handroanthus impetiginosus] Length = 428 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ LLHILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYYNDWLLHILADTNSTFFGIQG 58 Score = 29.3 bits (64), Expect(2) = 5e-09 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV 561 F I GP ML+FTF ILFI V Sbjct: 54 FGIQGPIMLDFTFPILFIAV 73 >gb|EYU32154.1| hypothetical protein MIMGU_mgv1a002115mg [Erythranthe guttata] Length = 711 Score = 59.7 bits (143), Expect(2) = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ LLHILA TNSTFFG++G Sbjct: 35 MWIIMPTDTYYNDWLLHILAATNSTFFGIQG 65 Score = 28.9 bits (63), Expect(2) = 7e-09 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV 561 F I GP ML+FTF ILFI + Sbjct: 61 FGIQGPIMLDFTFPILFIAI 80 >ref|XP_012843765.1| PREDICTED: ferric reduction oxidase 2-like [Erythranthe guttata] Length = 706 Score = 59.7 bits (143), Expect(2) = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ LLHILA TNSTFFG++G Sbjct: 30 MWIIMPTDTYYNDWLLHILAATNSTFFGIQG 60 Score = 28.9 bits (63), Expect(2) = 7e-09 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV 561 F I GP ML+FTF ILFI + Sbjct: 56 FGIQGPIMLDFTFPILFIAI 75 >gb|KZV37824.1| ferric reduction oxidase 2 [Dorcoceras hygrometricum] Length = 671 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYY+N LLHILA TNST+FG++G Sbjct: 28 MWIIMPTDTYYDNWLLHILADTNSTYFGIQG 58 Score = 29.3 bits (64), Expect(2) = 1e-08 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV--CIW 570 F I GP ML+FTF ILFI + C++ Sbjct: 54 FGIQGPIMLDFTFPILFIAILGCVY 78 >gb|EPS59494.1| hypothetical protein M569_15313, partial [Genlisea aurea] Length = 237 Score = 57.8 bits (138), Expect(2) = 4e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 303 FLSIIID*H*KPMWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 FLS++I MWIIMPTDTYYN+ L HILA T+STFFG++G Sbjct: 18 FLSLVIFLGNIMMWIIMPTDTYYNHWLKHILASTDSTFFGIQG 60 Score = 28.5 bits (62), Expect(2) = 4e-08 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFI 555 F I GP ML+FTF ILFI Sbjct: 56 FGIQGPIMLDFTFPILFI 73 >gb|PIN05823.1| Ferric reductase, NADH/NADPH oxidase [Handroanthus impetiginosus] Length = 704 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTYYN+ L HILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYYNDWLPHILAATNSTFFGIQG 58 Score = 26.9 bits (58), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV--CIW 570 F I GP ML+FT I+FI V CI+ Sbjct: 54 FGIQGPIMLDFTLPIMFIAVLGCIY 78 >emb|CDP08776.1| unnamed protein product [Coffea canephora] Length = 717 Score = 52.4 bits (124), Expect(2) = 8e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MW IMPTDTYYN + HI+A TNST+FG++G Sbjct: 39 MWCIMPTDTYYNKWVPHIMASTNSTYFGLQG 69 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFIDV--CIW 570 F + GP ML+FTF ILFI V CI+ Sbjct: 65 FGLQGPIMLDFTFPILFIAVMGCIY 89 >ref|XP_022895493.1| ferric reduction oxidase 2-like isoform X1 [Olea europaea var. sylvestris] Length = 434 Score = 53.1 bits (126), Expect(2) = 8e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTY++ L HILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYHDKWLPHILADTNSTFFGIQG 58 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFI 555 F I GP ML+FTF ILFI Sbjct: 54 FGIQGPIMLDFTFPILFI 71 >ref|XP_022895494.1| ferric reduction oxidase 2-like isoform X2 [Olea europaea var. sylvestris] Length = 411 Score = 53.1 bits (126), Expect(2) = 8e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 339 MWIIMPTDTYYNNCLLHILAHTNSTFFGMKG 431 MWIIMPTDTY++ L HILA TNSTFFG++G Sbjct: 28 MWIIMPTDTYHDKWLPHILADTNSTFFGIQG 58 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 502 FCITGPTMLNFTFSILFI 555 F I GP ML+FTF ILFI Sbjct: 54 FGIQGPIMLDFTFPILFI 71