BLASTX nr result
ID: Rehmannia31_contig00027697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027697 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071620.1| ABC transporter A family member 2 [Sesamum i... 86 6e-17 gb|KZV21680.1| ABC transporter A family member 2-like [Dorcocera... 82 2e-15 ref|XP_022885220.1| ABC transporter A family member 2 [Olea euro... 69 4e-11 ref|XP_012839393.1| PREDICTED: ABC transporter A family member 2... 68 9e-11 ref|XP_019198129.1| PREDICTED: ABC transporter A family member 2... 68 1e-10 ref|XP_022843392.1| ABC transporter A family member 2-like [Olea... 65 8e-10 ref|XP_016498795.1| PREDICTED: ABC transporter A family member 2... 64 3e-09 ref|XP_009759241.1| PREDICTED: ABC transporter A family member 2... 64 3e-09 ref|XP_016563601.1| PREDICTED: ABC transporter A family member 2... 62 6e-09 emb|CDP12365.1| unnamed protein product [Coffea canephora] 63 7e-09 gb|PHT88095.1| ABC transporter A family member 2 [Capsicum annuum] 62 1e-08 gb|PHU23786.1| ABC transporter A family member 2 [Capsicum chine... 62 1e-08 ref|XP_016563600.1| PREDICTED: ABC transporter A family member 2... 62 1e-08 ref|XP_009615368.1| PREDICTED: ABC transporter A family member 2... 62 1e-08 ref|XP_015696021.1| PREDICTED: ABC transporter A family member 2... 62 2e-08 gb|KDO36425.1| hypothetical protein CISIN_1g046109mg, partial [C... 59 2e-08 ref|XP_015162853.1| PREDICTED: ABC transporter A family member 2... 61 3e-08 ref|XP_006344386.1| PREDICTED: ABC transporter A family member 2... 61 3e-08 ref|XP_008385267.1| PREDICTED: ABC transporter A family member 2... 61 3e-08 ref|XP_017695930.1| PREDICTED: ABC transporter A family member 2... 60 5e-08 >ref|XP_011071620.1| ABC transporter A family member 2 [Sesamum indicum] Length = 965 Score = 85.9 bits (211), Expect = 6e-17 Identities = 43/58 (74%), Positives = 46/58 (79%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSDLR 199 DDSGALCISGYSDE+PIPPHVQL S S+ N S R+RQV G VIDPSQI DSDLR Sbjct: 908 DDSGALCISGYSDEMPIPPHVQLPPTSAPTSNLNISGRRRQVHGIVIDPSQIADSDLR 965 >gb|KZV21680.1| ABC transporter A family member 2-like [Dorcoceras hygrometricum] Length = 968 Score = 81.6 bits (200), Expect = 2e-15 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSDLRR 196 DDSGALCISG S+E PIPPH+QLG+ ST S R+ RR+++V G VIDP+QI DSDL+R Sbjct: 910 DDSGALCISGQSEEFPIPPHIQLGSNSTPTSRRDILRRKKKVHGIVIDPAQIRDSDLQR 968 >ref|XP_022885220.1| ABC transporter A family member 2 [Olea europaea var. sylvestris] Length = 991 Score = 69.3 bits (168), Expect = 4e-11 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSDL 202 DD+GALCISG+S+E+PIPPHVQL +ST S N R++++ G VIDP+QI +S L Sbjct: 935 DDAGALCISGHSNEMPIPPHVQLRESSTPTSSINILGRRQKIRGIVIDPAQITNSSL 991 >ref|XP_012839393.1| PREDICTED: ABC transporter A family member 2 [Erythranthe guttata] gb|EYU35871.1| hypothetical protein MIMGU_mgv1a000845mg [Erythranthe guttata] Length = 963 Score = 68.2 bits (165), Expect = 9e-11 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSDLR 199 DDSG+LCISGYS+ IPIP HV L ++ H R RQ+ G VIDPSQI+DSDLR Sbjct: 910 DDSGSLCISGYSESIPIPSHVDLPPPTSSTPH----GRNRQLRGIVIDPSQILDSDLR 963 >ref|XP_019198129.1| PREDICTED: ABC transporter A family member 2 [Ipomoea nil] Length = 965 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S+E+PIPPHVQL T S RR+R++LG VIDP+QI Sbjct: 908 DDSGRLCISGHSEEMPIPPHVQLTATPTPTSGWGLRRRRRKILGIVIDPAQI 959 >ref|XP_022843392.1| ABC transporter A family member 2-like [Olea europaea var. sylvestris] Length = 926 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSDL 202 DD+GALCISG+SD+ PIPPHVQL S S + R++Q+ G VIDP QI +S++ Sbjct: 870 DDAGALCISGHSDDTPIPPHVQLRATSAPTSGISILGRRQQIHGIVIDPDQITNSNM 926 >ref|XP_016498795.1| PREDICTED: ABC transporter A family member 2-like [Nicotiana tabacum] Length = 963 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDS 208 DDSG+LC+SG+S ++PIP HVQL S R RR++Q+ G VIDP+QI D+ Sbjct: 907 DDSGSLCVSGHSQDMPIPAHVQLRDPPAATSGRGFLRRRKQIHGIVIDPAQITDA 961 >ref|XP_009759241.1| PREDICTED: ABC transporter A family member 2 [Nicotiana sylvestris] Length = 963 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDS 208 DDSG+LC+SG+S ++PIP HVQL S R RR++Q+ G VIDP+QI D+ Sbjct: 907 DDSGSLCVSGHSQDMPIPAHVQLRDPPAATSGRGFLRRRKQIHGIVIDPAQITDA 961 >ref|XP_016563601.1| PREDICTED: ABC transporter A family member 2-like [Capsicum annuum] Length = 242 Score = 62.0 bits (149), Expect = 6e-09 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP H+QL T S RN RQ+Q G VIDP+QI Sbjct: 186 DDSGTLCISGHSQDMPIPAHIQLRDPPTATSGRNILGRQKQNHGIVIDPAQI 237 >emb|CDP12365.1| unnamed protein product [Coffea canephora] Length = 954 Score = 62.8 bits (151), Expect = 7e-09 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDSD 205 DD GALCIS +S E+PIP HVQL +ST RN S R++QV G VIDP QI D+D Sbjct: 899 DDCGALCISHHSQEMPIPSHVQLRASSTA-LRRNFSGRRKQVDGFVIDPIQIFDTD 953 >gb|PHT88095.1| ABC transporter A family member 2 [Capsicum annuum] Length = 358 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP H+QL T S RN RQ+Q G VIDP+QI Sbjct: 302 DDSGTLCISGHSQDMPIPAHIQLRDPPTATSGRNILGRQKQNHGIVIDPAQI 353 >gb|PHU23786.1| ABC transporter A family member 2 [Capsicum chinense] Length = 897 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP H+QL T S RN RQ+Q G VIDP+QI Sbjct: 841 DDSGTLCISGHSQDMPIPAHIQLRDPPTATSGRNILGRQKQNHGIVIDPAQI 892 >ref|XP_016563600.1| PREDICTED: ABC transporter A family member 2-like [Capsicum annuum] Length = 963 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP H+QL T S RN RQ+Q G VIDP+QI Sbjct: 907 DDSGTLCISGHSQDMPIPAHIQLRDPPTATSGRNILGRQKQNHGIVIDPAQI 958 >ref|XP_009615368.1| PREDICTED: ABC transporter A family member 2 [Nicotiana tomentosiformis] Length = 963 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG+LC+SG+S ++PIP HVQL S R+ RR++Q+ G VIDP+QI Sbjct: 907 DDSGSLCVSGHSQDMPIPAHVQLRDPPAATSGRSFLRRRKQIRGIVIDPAQI 958 >ref|XP_015696021.1| PREDICTED: ABC transporter A family member 2 [Oryza brachyantha] Length = 966 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDS 208 DD+G+LCISG+SD+IP+PP+VQLG +L S R ++RR +G VIDP+++ S Sbjct: 912 DDNGSLCISGHSDQIPVPPNVQLGRPPSL-SRRASARRGNHPVGYVIDPNEVTAS 965 >gb|KDO36425.1| hypothetical protein CISIN_1g046109mg, partial [Citrus sinensis] Length = 155 Score = 59.3 bits (142), Expect = 2e-08 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVD 211 DD+GALCISG+S E PIPPHV+L +S S N + V G VIDP+QI D Sbjct: 102 DDTGALCISGHSPEKPIPPHVELDASSASTSRGNLFGQTGPVHGIVIDPNQIGD 155 >ref|XP_015162853.1| PREDICTED: ABC transporter A family member 2 isoform X2 [Solanum tuberosum] Length = 955 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP HVQL T S R+++Q+ GTVIDP+QI Sbjct: 899 DDSGRLCISGHSPDMPIPAHVQLRDPPTDTSSSGFLRKRKQIQGTVIDPAQI 950 >ref|XP_006344386.1| PREDICTED: ABC transporter A family member 2 isoform X1 [Solanum tuberosum] Length = 963 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSG LCISG+S ++PIP HVQL T S R+++Q+ GTVIDP+QI Sbjct: 907 DDSGRLCISGHSPDMPIPAHVQLRDPPTDTSSSGFLRKRKQIQGTVIDPAQI 958 >ref|XP_008385267.1| PREDICTED: ABC transporter A family member 2-like [Malus domestica] Length = 966 Score = 60.8 bits (146), Expect = 3e-08 Identities = 33/52 (63%), Positives = 36/52 (69%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQI 217 DDSGALCISGYS E PIPPHV+ ++S S R S R RQV G VI P QI Sbjct: 909 DDSGALCISGYSAEAPIPPHVESMSSSAPTSRR--SSRSRQVHGIVIHPDQI 958 >ref|XP_017695930.1| PREDICTED: ABC transporter A family member 2-like isoform X2 [Phoenix dactylifera] Length = 962 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = -2 Query: 372 DDSGALCISGYSDEIPIPPHVQLGTASTLNSHRNTSRRQRQVLGTVIDPSQIVDS 208 DDSG LCISG+S E PIPP++QL TA+ S R++ R ++G +IDP+Q+++S Sbjct: 908 DDSGTLCISGHSSEAPIPPNIQL-TANPALSRRSSHREPAPIVGYIIDPNQVLNS 961