BLASTX nr result
ID: Rehmannia31_contig00027645
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027645 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076617.1| putative pentatricopeptide repeat-containing... 127 2e-31 ref|XP_012858562.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-25 ref|XP_016460770.1| PREDICTED: putative pentatricopeptide repeat... 55 4e-06 ref|XP_009624329.1| PREDICTED: putative pentatricopeptide repeat... 55 4e-06 ref|XP_016460763.1| PREDICTED: putative pentatricopeptide repeat... 55 4e-06 ref|XP_009624328.1| PREDICTED: putative pentatricopeptide repeat... 55 4e-06 >ref|XP_011076617.1| putative pentatricopeptide repeat-containing protein At3g47840 [Sesamum indicum] ref|XP_020549219.1| putative pentatricopeptide repeat-containing protein At3g47840 [Sesamum indicum] Length = 771 Score = 127 bits (319), Expect = 2e-31 Identities = 64/100 (64%), Positives = 79/100 (79%) Frame = -2 Query: 301 MAISFNAEFQFLGCVHDRQLFKPSVPNRKENFLQARKIAATVAFQSIHKRNRVVGSKLFE 122 MAI+F ++ Q LG VHDR+LFKP V NRKE A+K +A +AFQSI++R RVVGSKLFE Sbjct: 1 MAINFPSKLQLLGSVHDRELFKPKVSNRKE----AKKSSAAIAFQSINERTRVVGSKLFE 56 Query: 121 FGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 FGA YE S+K QVQ+L+DQLH CAEK LLT R +HG++L Sbjct: 57 FGANYEYSQKAQVQKLVDQLHSCAEKGLLTETREIHGYLL 96 >ref|XP_012858562.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Erythranthe guttata] ref|XP_012858563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Erythranthe guttata] Length = 771 Score = 110 bits (274), Expect = 2e-25 Identities = 58/100 (58%), Positives = 71/100 (71%) Frame = -2 Query: 301 MAISFNAEFQFLGCVHDRQLFKPSVPNRKENFLQARKIAATVAFQSIHKRNRVVGSKLFE 122 MAIS +A+F LG H R LF+P NRKE AR +AA AFQS+H+R+R+VGSKLF+ Sbjct: 1 MAISCHAKFLSLGSFHSRGLFEPGFSNRKE----ARNLAAAKAFQSVHERSRIVGSKLFQ 56 Query: 121 FGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 YE S+K Q QELIDQLH CA+K LL A V+HG+VL Sbjct: 57 VDENYEFSQKAQRQELIDQLHLCAQKELLREASVIHGYVL 96 >ref|XP_016460770.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X2 [Nicotiana tabacum] Length = 761 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -2 Query: 157 KRNRVVGSKLFEFGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 + N VV +K+ E +YE+S K QVQ+L+D LH CAE+ LL + +HG++L Sbjct: 35 RNNGVVCNKMLETSVSYEASNKAQVQKLVDLLHVCAEEELLDETKTIHGYIL 86 >ref|XP_009624329.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X2 [Nicotiana tomentosiformis] Length = 761 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -2 Query: 157 KRNRVVGSKLFEFGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 + N VV +K+ E +YE+S K QVQ+L+D LH CAE+ LL + +HG++L Sbjct: 35 RNNGVVCNKMLETSVSYEASNKAQVQKLVDLLHVCAEEELLDETKTIHGYIL 86 >ref|XP_016460763.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X1 [Nicotiana tabacum] Length = 786 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -2 Query: 157 KRNRVVGSKLFEFGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 + N VV +K+ E +YE+S K QVQ+L+D LH CAE+ LL + +HG++L Sbjct: 60 RNNGVVCNKMLETSVSYEASNKAQVQKLVDLLHVCAEEELLDETKTIHGYIL 111 >ref|XP_009624328.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g56570 isoform X1 [Nicotiana tomentosiformis] Length = 786 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -2 Query: 157 KRNRVVGSKLFEFGATYESSEKDQVQELIDQLHRCAEKRLLTGARVVHGFVL 2 + N VV +K+ E +YE+S K QVQ+L+D LH CAE+ LL + +HG++L Sbjct: 60 RNNGVVCNKMLETSVSYEASNKAQVQKLVDLLHVCAEEELLDETKTIHGYIL 111