BLASTX nr result
ID: Rehmannia31_contig00027549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027549 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836895.1| PREDICTED: uncharacterized protein LOC105957... 62 4e-09 >ref|XP_012836895.1| PREDICTED: uncharacterized protein LOC105957515 [Erythranthe guttata] Length = 217 Score = 62.4 bits (150), Expect = 4e-09 Identities = 29/79 (36%), Positives = 42/79 (53%) Frame = +2 Query: 2 PGVRFNKFTNKFYISPSYWEQIGRESNMQRYFRTNGFPRYHDCVEIFYNRETVDIDFEGL 181 PGV FN T K + S+W +E+ +R FR NGFP + DC +F + +DF G+ Sbjct: 65 PGVTFNVNTRKVTVDRSFWPVTLKETVEERTFRINGFPLFEDCHFVFDVKHAPAVDFRGV 124 Query: 182 PGYNCDNPLEFEGSSSDEE 238 GY+ D P+ DE+ Sbjct: 125 EGYDPDYPVVIHNDDDDEQ 143