BLASTX nr result
ID: Rehmannia31_contig00027414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027414 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099701.1| pentatricopeptide repeat-containing protein ... 77 2e-13 ref|XP_009785187.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_009785186.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_016490072.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_015893986.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004233584.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_016487697.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_009613030.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_022880197.1| pentatricopeptide repeat-containing protein ... 58 1e-06 ref|XP_015893987.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|PHT57469.1| hypothetical protein CQW23_05955 [Capsicum baccatum] 57 3e-06 ref|XP_019238801.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|OIT21485.1| pentatricopeptide repeat-containing protein [Nico... 57 3e-06 ref|XP_015064370.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|PHU27849.1| hypothetical protein BC332_06181 [Capsicum chinense] 56 5e-06 gb|PHT92070.1| hypothetical protein T459_07183 [Capsicum annuum] 56 5e-06 ref|XP_016561746.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >ref|XP_011099701.1| pentatricopeptide repeat-containing protein At5g14080-like [Sesamum indicum] ref|XP_011099702.1| pentatricopeptide repeat-containing protein At5g14080-like [Sesamum indicum] ref|XP_020554676.1| pentatricopeptide repeat-containing protein At5g14080-like [Sesamum indicum] Length = 649 Score = 77.4 bits (189), Expect = 2e-13 Identities = 41/56 (73%), Positives = 43/56 (76%) Frame = -2 Query: 505 TFGIGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSSL 338 T GIGC +SHL LL YL DIGEL LATEHIQ +A KSP LL IQTE AAS SSSL Sbjct: 573 TCGIGCPKSHLTLLNYLADIGELPLATEHIQCIADKSPTLLHTIQTELAASLSSSL 628 >ref|XP_009785187.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 isoform X2 [Nicotiana sylvestris] Length = 586 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLI L++L D GE+S+A EH++W+ GKSP++ A+ E AS SSS Sbjct: 504 IAFLDSHLIFLKFLADAGEISMAVEHLKWIQGKSPSMYQALSNEILASISSS 555 >ref|XP_009785186.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 isoform X1 [Nicotiana sylvestris] Length = 652 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLI L++L D GE+S+A EH++W+ GKSP++ A+ E AS SSS Sbjct: 570 IAFLDSHLIFLKFLADAGEISMAVEHLKWIQGKSPSMYQALSNEILASISSS 621 >ref|XP_016490072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Nicotiana tabacum] Length = 700 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLI L++L D GE+S+A EH++W+ GKSP++ A+ E AS SSS Sbjct: 570 IAFLDSHLIFLKFLADAGEISMAVEHLKWIQGKSPSMYQALSNEILASISSS 621 >ref|XP_015893986.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like isoform X1 [Ziziphus jujuba] ref|XP_015865894.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like isoform X1 [Ziziphus jujuba] Length = 643 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -2 Query: 505 TFGIGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 TF + SH+ILL+YL D GE+ +A EH+ WV SP++L I+TE +AS SSS Sbjct: 568 TFDVAHSSSHVILLKYLADAGEVPIAIEHVNWVRETSPSMLQMIRTELSASLSSS 622 >ref|XP_004233584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 [Solanum lycopersicum] Length = 647 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -2 Query: 487 LESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 L+SHLI L++L D E+SLA EH++W+ GKSP + LA+ E AS SSS Sbjct: 566 LDSHLIFLKFLADAEEISLAVEHLKWIQGKSPLMHLAVSNEILASISSS 614 >ref|XP_016487697.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Nicotiana tabacum] Length = 651 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 + L+SHLI L++L D GE+SLA EH++W+ GKSP+ A+ E AS SS+ Sbjct: 569 VAFLDSHLIFLKFLADAGEISLAVEHLKWIQGKSPSTYQALSNEILASISST 620 >ref|XP_009613030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 [Nicotiana tomentosiformis] Length = 651 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 + L+SHLI L++L D GE+SLA EH++W+ GKSP+ A+ E AS SS+ Sbjct: 569 VAFLDSHLIFLKFLADAGEISLAVEHLKWIQGKSPSTYQALSNEILASISST 620 >ref|XP_022880197.1| pentatricopeptide repeat-containing protein At5g14080 isoform X1 [Olea europaea var. sylvestris] Length = 646 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 IG ESH+ LL+YL D GELSL EHI+WV KS LL I TE + + SSS Sbjct: 569 IGYTESHMTLLKYLADAGELSLVIEHIKWVREKSHTLLHCILTEVSVALSSS 620 >ref|XP_015893987.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like isoform X2 [Ziziphus jujuba] ref|XP_015865895.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like isoform X2 [Ziziphus jujuba] Length = 626 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 481 SHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 SH+ILL+YL D GE+ +A EH+ WV SP++L I+TE +AS SSS Sbjct: 559 SHVILLKYLADAGEVPIAIEHVNWVRETSPSMLQMIRTELSASLSSS 605 >gb|PHT57469.1| hypothetical protein CQW23_05955 [Capsicum baccatum] Length = 651 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLILL++L + E+SLA EH++W+ GKSP++ A+ E AS +SS Sbjct: 569 ITLLDSHLILLKFLANADEISLAVEHLKWIQGKSPSMHQALSKEILASIASS 620 >ref|XP_019238801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 isoform X1 [Nicotiana attenuata] Length = 652 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLI L++L D GE+SLA EH++ + GKSP++ A+ E AS SSS Sbjct: 570 IAFLDSHLIFLKFLADTGEISLAVEHLKCIQGKSPSMHQALSNEILASISSS 621 >gb|OIT21485.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 659 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLI L++L D GE+SLA EH++ + GKSP++ A+ E AS SSS Sbjct: 577 IAFLDSHLIFLKFLADTGEISLAVEHLKCIQGKSPSMHQALSNEILASISSS 628 >ref|XP_015064370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 [Solanum pennellii] Length = 668 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -2 Query: 487 LESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 L SHLI L++L D E+SLA EH++W+ GKSP + A+ E AS SSS Sbjct: 566 LNSHLIFLKFLADAEEISLAVEHLKWIQGKSPLMHQAVSNEILASISSS 614 >gb|PHU27849.1| hypothetical protein BC332_06181 [Capsicum chinense] Length = 651 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLILL++L + E+SLA EH++W+ GKSP + A+ E AS +SS Sbjct: 569 ITLLDSHLILLKFLANADEISLAVEHLKWIQGKSPLMHQALSNEILASIASS 620 >gb|PHT92070.1| hypothetical protein T459_07183 [Capsicum annuum] Length = 651 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLILL++L + E+SLA EH++W+ GKSP + A+ E AS +SS Sbjct: 569 ITLLDSHLILLKFLANADEISLAVEHLKWIQGKSPLMHQALSNEILASIASS 620 >ref|XP_016561746.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080 [Capsicum annuum] Length = 651 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 496 IGCLESHLILLRYLVDIGELSLATEHIQWVAGKSPALLLAIQTESAASFSSS 341 I L+SHLILL++L + E+SLA EH++W+ GKSP + A+ E AS +SS Sbjct: 569 ITLLDSHLILLKFLANADEISLAVEHLKWIQGKSPLMHQALSNEILASIASS 620