BLASTX nr result
ID: Rehmannia31_contig00027248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027248 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083845.1| protein CYPRO4 [Sesamum indicum] 70 2e-11 gb|KZV48082.1| dem protein [Dorcoceras hygrometricum] 62 1e-08 ref|XP_022884806.1| protein CYPRO4 [Olea europaea var. sylvestris] 59 8e-08 gb|EPS57429.1| hypothetical protein M569_17387, partial [Genlise... 57 5e-07 ref|XP_012851706.1| PREDICTED: protein CYPRO4 [Erythranthe gutta... 57 5e-07 >ref|XP_011083845.1| protein CYPRO4 [Sesamum indicum] Length = 647 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 125 YGTPSSHPSDHKQRDPKTPSSLDEVESRLKALKLKY 18 +GTPSSHPSDHK+ DP+TPSSLDEVE+RLKALKLKY Sbjct: 35 FGTPSSHPSDHKRTDPQTPSSLDEVEARLKALKLKY 70 >gb|KZV48082.1| dem protein [Dorcoceras hygrometricum] Length = 640 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 125 YGTPSSHPSDHKQRDPKTPSSLDEVESRLKALKLKY 18 YGTPSS+PSD + RDPKTPSSL++VESRLKALKLKY Sbjct: 35 YGTPSSNPSDQR-RDPKTPSSLEDVESRLKALKLKY 69 >ref|XP_022884806.1| protein CYPRO4 [Olea europaea var. sylvestris] Length = 644 Score = 59.3 bits (142), Expect = 8e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 125 YGTPSSHPSDHKQRDPKTPSSLDEVESRLKALKLKY 18 YGTPSS+ SDH + PKTPSSLDEVESRLKALKLKY Sbjct: 36 YGTPSSYSSDHPK--PKTPSSLDEVESRLKALKLKY 69 >gb|EPS57429.1| hypothetical protein M569_17387, partial [Genlisea aurea] Length = 639 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 125 YGTPSSHPSDHKQRDPKTPSSLDEVESRLKALKLKY 18 YGTP H SDH Q++P TPSSL+EV SRLK LKLKY Sbjct: 35 YGTPVFHASDHNQKEPTTPSSLEEVGSRLKELKLKY 70 >ref|XP_012851706.1| PREDICTED: protein CYPRO4 [Erythranthe guttata] gb|EYU25421.1| hypothetical protein MIMGU_mgv1a002618mg [Erythranthe guttata] Length = 653 Score = 57.0 bits (136), Expect = 5e-07 Identities = 30/41 (73%), Positives = 31/41 (75%), Gaps = 5/41 (12%) Frame = -3 Query: 125 YGTPSSHPSD-----HKQRDPKTPSSLDEVESRLKALKLKY 18 YGTPSSHPS K DP TPSSLDEVESRL+ALKLKY Sbjct: 35 YGTPSSHPSGGGGSGKKITDPNTPSSLDEVESRLRALKLKY 75