BLASTX nr result
ID: Rehmannia31_contig00027054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00027054 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20972.1| Leucine rich repeat protein [Handroanthus impetig... 65 1e-09 ref|XP_019264889.1| PREDICTED: F-box protein At5g51380-like [Nic... 63 7e-09 ref|XP_011090156.1| F-box protein At5g51370-like [Sesamum indicum] 62 9e-09 gb|PHT95402.1| F-box protein [Capsicum annuum] 62 1e-08 ref|XP_006339700.1| PREDICTED: F-box protein At5g51380-like isof... 62 1e-08 ref|XP_015062121.1| PREDICTED: F-box protein At5g51380-like [Sol... 62 1e-08 ref|XP_010327021.1| PREDICTED: F-box protein At5g51380-like [Sol... 62 1e-08 gb|PHT60687.1| F-box protein [Capsicum baccatum] 62 1e-08 gb|PHU31032.1| F-box protein [Capsicum chinense] 62 1e-08 ref|XP_016544580.1| PREDICTED: F-box protein At5g51380-like [Cap... 62 1e-08 gb|EYU31941.1| hypothetical protein MIMGU_mgv1a019754mg [Erythra... 61 2e-08 ref|XP_012843559.1| PREDICTED: F-box protein At5g51370-like [Ery... 61 2e-08 gb|OMO69521.1| hypothetical protein CCACVL1_19454 [Corchorus cap... 61 2e-08 gb|OMP00671.1| hypothetical protein COLO4_12472 [Corchorus olito... 61 2e-08 ref|XP_009631122.1| PREDICTED: F-box protein At5g51380-like [Nic... 61 3e-08 ref|XP_010692147.1| PREDICTED: F-box protein At5g51380 isoform X... 60 6e-08 ref|XP_021849333.1| F-box protein At5g51380-like [Spinacia olera... 60 6e-08 ref|XP_010692144.1| PREDICTED: F-box protein At5g51380 isoform X... 60 6e-08 emb|CAN69546.1| hypothetical protein VITISV_010819 [Vitis vinifera] 60 8e-08 ref|XP_022897202.1| F-box protein At5g07670-like isoform X1 [Ole... 60 8e-08 >gb|PIN20972.1| Leucine rich repeat protein [Handroanthus impetiginosus] Length = 500 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNNVRDSEITPELA+LFS+LKELKWRP+ Sbjct: 444 KVVSCNNVRDSEITPELAILFSVLKELKWRPD 475 >ref|XP_019264889.1| PREDICTED: F-box protein At5g51380-like [Nicotiana attenuata] gb|OIT36094.1| f-box protein [Nicotiana attenuata] Length = 500 Score = 62.8 bits (151), Expect = 7e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 +V+SCNN++DSEITPELA LFS+LKELKWRPN Sbjct: 444 RVVSCNNIKDSEITPELATLFSVLKELKWRPN 475 >ref|XP_011090156.1| F-box protein At5g51370-like [Sesamum indicum] Length = 497 Score = 62.4 bits (150), Expect = 9e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KVI+CNNVRDSEITPELA LFS+LKELKWRP+ Sbjct: 441 KVIACNNVRDSEITPELATLFSLLKELKWRPD 472 >gb|PHT95402.1| F-box protein [Capsicum annuum] Length = 455 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 399 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 430 >ref|XP_006339700.1| PREDICTED: F-box protein At5g51380-like isoform X1 [Solanum tuberosum] Length = 499 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 443 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 474 >ref|XP_015062121.1| PREDICTED: F-box protein At5g51380-like [Solanum pennellii] ref|XP_015062122.1| PREDICTED: F-box protein At5g51380-like [Solanum pennellii] ref|XP_015062123.1| PREDICTED: F-box protein At5g51380-like [Solanum pennellii] Length = 501 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 445 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 476 >ref|XP_010327021.1| PREDICTED: F-box protein At5g51380-like [Solanum lycopersicum] ref|XP_010327028.1| PREDICTED: F-box protein At5g51380-like [Solanum lycopersicum] Length = 501 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 445 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 476 >gb|PHT60687.1| F-box protein [Capsicum baccatum] Length = 502 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 446 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 477 >gb|PHU31032.1| F-box protein [Capsicum chinense] Length = 504 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 448 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 479 >ref|XP_016544580.1| PREDICTED: F-box protein At5g51380-like [Capsicum annuum] Length = 504 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 448 KVVSCNNIKDSEITPELATLFSVLKELKWRPD 479 >gb|EYU31941.1| hypothetical protein MIMGU_mgv1a019754mg [Erythranthe guttata] Length = 455 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KVISCNN++DSEITPEL+ LFS+LKELKWRP+ Sbjct: 399 KVISCNNIKDSEITPELSTLFSVLKELKWRPD 430 >ref|XP_012843559.1| PREDICTED: F-box protein At5g51370-like [Erythranthe guttata] Length = 502 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KVISCNN++DSEITPEL+ LFS+LKELKWRP+ Sbjct: 446 KVISCNNIKDSEITPELSTLFSVLKELKWRPD 477 >gb|OMO69521.1| hypothetical protein CCACVL1_19454 [Corchorus capsularis] Length = 527 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPNXXXXXXXXXEVQESGKK 147 +V+SCNN++D+E+TPELA LFS+LKELKWRP+ E GKK Sbjct: 469 RVVSCNNIKDTEVTPELATLFSVLKELKWRPDSRSLLSSNLEGTGMGKK 517 >gb|OMP00671.1| hypothetical protein COLO4_12472 [Corchorus olitorius] Length = 528 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPNXXXXXXXXXEVQESGKK 147 +V+SCNN++D+E+TPELA LFS+LKELKWRP+ E GKK Sbjct: 470 RVVSCNNIKDTEVTPELATLFSVLKELKWRPDSRSLLSSNLEGTGMGKK 518 >ref|XP_009631122.1| PREDICTED: F-box protein At5g51380-like [Nicotiana tomentosiformis] ref|XP_016501649.1| PREDICTED: F-box protein At5g51380-like [Nicotiana tabacum] Length = 501 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 +V+SCNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 445 RVVSCNNIKDSEITPELATLFSVLKELKWRPD 476 >ref|XP_010692147.1| PREDICTED: F-box protein At5g51380 isoform X2 [Beta vulgaris subsp. vulgaris] gb|KMT00015.1| hypothetical protein BVRB_1g018460 isoform B [Beta vulgaris subsp. vulgaris] Length = 476 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCN+++DSEITPELA LFS+LKELKWRP+ Sbjct: 420 KVVSCNSIKDSEITPELATLFSVLKELKWRPD 451 >ref|XP_021849333.1| F-box protein At5g51380-like [Spinacia oleracea] gb|KNA22771.1| hypothetical protein SOVF_031550 [Spinacia oleracea] Length = 483 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCN+++DSEITPELA LFS+LKELKWRP+ Sbjct: 425 KVVSCNSIKDSEITPELATLFSVLKELKWRPD 456 >ref|XP_010692144.1| PREDICTED: F-box protein At5g51380 isoform X1 [Beta vulgaris subsp. vulgaris] ref|XP_010692145.1| PREDICTED: F-box protein At5g51380 isoform X1 [Beta vulgaris subsp. vulgaris] ref|XP_010692146.1| PREDICTED: F-box protein At5g51380 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT00014.1| hypothetical protein BVRB_1g018460 isoform A [Beta vulgaris subsp. vulgaris] Length = 484 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 KV+SCN+++DSEITPELA LFS+LKELKWRP+ Sbjct: 420 KVVSCNSIKDSEITPELATLFSVLKELKWRPD 451 >emb|CAN69546.1| hypothetical protein VITISV_010819 [Vitis vinifera] Length = 376 Score = 59.7 bits (143), Expect = 8e-08 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPNXXXXXXXXXEVQESGKKVVEL 159 +V+SCNN++DSE+TP LA LFS+LKELKWRP+ GKK V L Sbjct: 299 RVVSCNNIKDSEVTPALATLFSVLKELKWRPDSRSLLSSSLGETGMGKKGVSL 351 >ref|XP_022897202.1| F-box protein At5g07670-like isoform X1 [Olea europaea var. sylvestris] Length = 505 Score = 59.7 bits (143), Expect = 8e-08 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +1 Query: 1 KVISCNNVRDSEITPELALLFSILKELKWRPN 96 +V++CNN++DSEITPELA LFS+LKELKWRP+ Sbjct: 450 RVVACNNIKDSEITPELATLFSVLKELKWRPD 481