BLASTX nr result
ID: Rehmannia31_contig00026860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026860 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086521.1| DEAD-box ATP-dependent RNA helicase 21 [Sesa... 59 9e-08 gb|PIN13293.1| U5 snRNP-like RNA helicase subunit [Handroanthus ... 59 1e-07 >ref|XP_011086521.1| DEAD-box ATP-dependent RNA helicase 21 [Sesamum indicum] Length = 720 Score = 59.3 bits (142), Expect = 9e-08 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 112 MKRAADDVVD---GAKKPVFLTKXXXXXXXXXXXXXXVAQQKRRTELLLQANNG 264 MKRA++DVVD GAKKPVFLTK VAQQKRR ELLLQANNG Sbjct: 1 MKRASEDVVDKVDGAKKPVFLTKEERQKLALQRRQEEVAQQKRRAELLLQANNG 54 >gb|PIN13293.1| U5 snRNP-like RNA helicase subunit [Handroanthus impetiginosus] Length = 722 Score = 58.9 bits (141), Expect = 1e-07 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 112 MKRAADDVV---DGAKKPVFLTKXXXXXXXXXXXXXXVAQQKRRTELLLQANNG 264 MKRA+DDVV DGAKKPVFLTK VAQQKRR ELLLQA+NG Sbjct: 1 MKRASDDVVEKLDGAKKPVFLTKEERQKLALQRREEEVAQQKRRAELLLQASNG 54