BLASTX nr result
ID: Rehmannia31_contig00026858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026858 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019189679.1| PREDICTED: uncharacterized protein LOC109184... 52 7e-06 >ref|XP_019189679.1| PREDICTED: uncharacterized protein LOC109184093 [Ipomoea nil] Length = 284 Score = 51.6 bits (122), Expect(2) = 7e-06 Identities = 20/40 (50%), Positives = 31/40 (77%) Frame = +2 Query: 197 RNNRVTCTLWEEYVDQILPFLEEGKFEPIVVILQMCRAKV 316 R +R+T TLWEE+VD +LP+ +P++VILQ+CRA++ Sbjct: 78 RGSRLTITLWEEHVDSVLPYYNADLTDPLIVILQLCRARL 117 Score = 25.8 bits (55), Expect(2) = 7e-06 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 3 CFMFIDIISRIVSMHSAKTTEITGRTTR 86 C ID+I R+VS+ KT ++ + R Sbjct: 41 CNQLIDLIGRVVSITEPKTIQVNSKPQR 68