BLASTX nr result
ID: Rehmannia31_contig00026803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026803 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07567.1| hypothetical protein CDL12_19865 [Handroanthus im... 62 1e-08 ref|XP_011087667.1| uncharacterized protein LOC105169085 [Sesamu... 59 2e-07 >gb|PIN07567.1| hypothetical protein CDL12_19865 [Handroanthus impetiginosus] Length = 355 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 6/56 (10%) Frame = -1 Query: 430 GNGY----MHYDECSHFFDRRMTDRTGSLATSPVSSSP-LGHGG-KTWDATVRGDI 281 GNG MHY++CSHF DRRM +RTGS+ PV SSP LGH G K WD T+ DI Sbjct: 300 GNGCCAKSMHYEDCSHFSDRRMMERTGSVGMRPVCSSPRLGHSGIKAWDGTLGEDI 355 >ref|XP_011087667.1| uncharacterized protein LOC105169085 [Sesamum indicum] Length = 352 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 2/48 (4%) Frame = -1 Query: 418 MHYDECSHFFDRRMTDRTGSLATSPVSSSP-LGHGG-KTWDATVRGDI 281 MH D+C HF DRR+ DRTGS SPV SSP HGG K WD+ + GD+ Sbjct: 303 MHNDDCIHFSDRRIADRTGSFTVSPVPSSPRYSHGGIKIWDSMINGDM 350