BLASTX nr result
ID: Rehmannia31_contig00026317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026317 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096615.1| DEAD-box ATP-dependent RNA helicase 1 isofor... 57 1e-06 ref|XP_011096614.1| DEAD-box ATP-dependent RNA helicase 1 isofor... 57 1e-06 >ref|XP_011096615.1| DEAD-box ATP-dependent RNA helicase 1 isoform X2 [Sesamum indicum] Length = 561 Score = 57.0 bits (136), Expect = 1e-06 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -1 Query: 426 ESFHSMYKTALERLKESVESEKYRKG--KVNTKRPGVTRKKENTA 298 ESF S+Y ALERLKESVESEK KG KVN K P VTRKKE + Sbjct: 507 ESFRSVYSRALERLKESVESEKRSKGKVKVNIKHPAVTRKKEKAS 551 >ref|XP_011096614.1| DEAD-box ATP-dependent RNA helicase 1 isoform X1 [Sesamum indicum] Length = 562 Score = 57.0 bits (136), Expect = 1e-06 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -1 Query: 426 ESFHSMYKTALERLKESVESEKYRKG--KVNTKRPGVTRKKENTA 298 ESF S+Y ALERLKESVESEK KG KVN K P VTRKKE + Sbjct: 508 ESFRSVYSRALERLKESVESEKRSKGKVKVNIKHPAVTRKKEKAS 552