BLASTX nr result
ID: Rehmannia31_contig00026240
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026240 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091522.1| uncharacterized protein LOC105171942 [Sesamu... 67 2e-09 ref|XP_012842522.1| PREDICTED: uncharacterized protein LOC105962... 58 2e-06 >ref|XP_011091522.1| uncharacterized protein LOC105171942 [Sesamum indicum] Length = 302 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 611 KCAGHLKRLHSLLLSEIEVKRNLRPFNCDKRMKVCRQRHPTFQ 483 KCAGHLKRLHS LLSEIEV+R L+PFN D+R+K+ RQR TF+ Sbjct: 260 KCAGHLKRLHSSLLSEIEVERTLKPFNRDRRVKIERQRQMTFK 302 >ref|XP_012842522.1| PREDICTED: uncharacterized protein LOC105962742 [Erythranthe guttata] gb|EYU33214.1| hypothetical protein MIMGU_mgv1a010457mg [Erythranthe guttata] gb|EYU33215.1| hypothetical protein MIMGU_mgv1a010457mg [Erythranthe guttata] Length = 311 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 614 HK-CAGHLKRLHSLLLSEIEVKRNLRPFNCDKRMKVCRQRHPTFQ 483 HK CAGHL+RLHS LLSEIE++R LRPFN +R K+ ++R +FQ Sbjct: 267 HKNCAGHLRRLHSSLLSEIEIERTLRPFNRGRREKLDKRRRSSFQ 311