BLASTX nr result
ID: Rehmannia31_contig00025996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025996 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus im... 88 1e-20 ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 85 2e-19 ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane d... 79 5e-17 gb|PIM97369.1| hypothetical protein CDL12_30160 [Handroanthus im... 78 8e-17 gb|PHT54566.1| hypothetical protein CQW23_09028 [Capsicum baccat... 77 3e-16 ref|XP_022744616.1| cysteine-rich and transmembrane domain-conta... 75 4e-15 gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium r... 73 9e-15 ref|XP_017610545.1| PREDICTED: cysteine-rich and transmembrane d... 73 1e-14 gb|PNT29678.1| hypothetical protein POPTR_006G043300v3 [Populus ... 73 2e-14 ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Popu... 73 2e-14 gb|OMO60111.1| hypothetical protein COLO4_33936 [Corchorus olito... 72 4e-14 gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] 71 5e-14 gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus cl... 70 1e-13 gb|OAY43280.1| hypothetical protein MANES_08G056600 [Manihot esc... 70 2e-13 emb|CBI30080.3| unnamed protein product, partial [Vitis vinifera] 68 8e-13 ref|XP_007028562.2| PREDICTED: cysteine-rich and transmembrane d... 68 1e-12 ref|XP_019090509.1| PREDICTED: cysteine-rich and transmembrane d... 67 3e-12 gb|OAY36205.1| hypothetical protein MANES_11G003500 [Manihot esc... 67 3e-12 ref|NP_196028.2| cysteine-rich TM module stress tolerance protei... 67 4e-12 ref|XP_002871075.1| cysteine-rich and transmembrane domain-conta... 67 4e-12 >gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus impetiginosus] Length = 58 Score = 88.2 bits (217), Expect = 1e-20 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCFD 209 KKKMKC+PRTKAKGERGFLEGCLFALCCCWLCEVCFD Sbjct: 22 KKKMKCWPRTKAKGERGFLEGCLFALCCCWLCEVCFD 58 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 85.1 bits (209), Expect = 2e-19 Identities = 38/58 (65%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = +3 Query: 42 QNQANQXXXXXXXXXXXXXKK--KMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCFD 209 +NQ NQ KK KMKCFPR+K KGERGFLEGCLFALCCCW+CEVCFD Sbjct: 5 ENQVNQPPPGYPTESTPTGKKNKKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCFD 62 >ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Solanum tuberosum] Length = 62 Score = 79.0 bits (193), Expect = 5e-17 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCFD 209 KKKMK +PR+K +GERGFLEGCLFALCCCWLCEVCFD Sbjct: 26 KKKMKGWPRSKPRGERGFLEGCLFALCCCWLCEVCFD 62 >gb|PIM97369.1| hypothetical protein CDL12_30160 [Handroanthus impetiginosus] Length = 52 Score = 78.2 bits (191), Expect = 8e-17 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +3 Query: 39 MQNQANQXXXXXXXXXXXXXKKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 MQNQANQ KK KC+PR+K KG+RGF+EGCLFALCCCW+C++CF Sbjct: 1 MQNQANQPPTGYPTEK----KKMKKCWPRSKPKGDRGFIEGCLFALCCCWICDICF 52 >gb|PHT54566.1| hypothetical protein CQW23_09028 [Capsicum baccatum] gb|PHT80581.1| hypothetical protein T459_13596 [Capsicum annuum] gb|PHU16661.1| hypothetical protein BC332_12356 [Capsicum chinense] Length = 63 Score = 77.0 bits (188), Expect = 3e-16 Identities = 34/61 (55%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +3 Query: 36 NMQNQANQXXXXXXXXXXXXXK----KKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVC 203 N +NQ NQ KKMKCFPR+K KGERGF+EGCL ALCCCW+C+VC Sbjct: 3 NQENQMNQPPPGYPTESTPTPSGKKNKKMKCFPRSKPKGERGFIEGCLAALCCCWICDVC 62 Query: 204 F 206 F Sbjct: 63 F 63 >ref|XP_022744616.1| cysteine-rich and transmembrane domain-containing protein WIH2 [Durio zibethinus] Length = 77 Score = 74.7 bits (182), Expect = 4e-15 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KCFPRTK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 46 KCFPRTKKKGDRGFIEGCLFALCCCWLCETCF 77 >gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 73.2 bits (178), Expect = 9e-15 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KCFPR+K KG+RGF+EGCLFALCCCWLCE CF Sbjct: 29 KCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 60 >ref|XP_017610545.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Gossypium arboreum] Length = 76 Score = 73.2 bits (178), Expect = 1e-14 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KCFPR+K KG+RGF+EGCLFALCCCWLCE CF Sbjct: 45 KCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 76 >gb|PNT29678.1| hypothetical protein POPTR_006G043300v3 [Populus trichocarpa] Length = 94 Score = 73.2 bits (178), Expect = 2e-14 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVC 203 KCFPRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 63 KCFPRTKKKGERGFIEGCLFALCCCWICEMC 93 >ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] Length = 94 Score = 73.2 bits (178), Expect = 2e-14 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVC 203 KCFPRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 63 KCFPRTKKKGERGFIEGCLFALCCCWICEMC 93 >gb|OMO60111.1| hypothetical protein COLO4_33936 [Corchorus olitorius] Length = 58 Score = 71.6 bits (174), Expect = 4e-14 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KC PRTK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 27 KCSPRTKKKGDRGFIEGCLFALCCCWLCEACF 58 >gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 71.2 bits (173), Expect = 5e-14 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 105 KMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 K KC P TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 23 KKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 70.5 bits (171), Expect = 1e-13 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 K K KC +TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 25 KGKKKCLSQTKKKGDRGFIEGCLFALCCCWLCEACF 60 >gb|OAY43280.1| hypothetical protein MANES_08G056600 [Manihot esculenta] Length = 56 Score = 69.7 bits (169), Expect = 2e-13 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KCF R+K KG+RGF+EGCLFALCCCWLCE CF Sbjct: 25 KCFNRSKKKGDRGFIEGCLFALCCCWLCEACF 56 >emb|CBI30080.3| unnamed protein product, partial [Vitis vinifera] Length = 56 Score = 68.2 bits (165), Expect = 8e-13 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 114 CFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 C PR+K+KG+RGF+EGCLFALCCCW+CE CF Sbjct: 26 CCPRSKSKGDRGFIEGCLFALCCCWICEACF 56 >ref|XP_007028562.2| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Theobroma cacao] Length = 56 Score = 67.8 bits (164), Expect = 1e-12 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 K F RTK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 25 KSFSRTKKKGDRGFIEGCLFALCCCWLCETCF 56 >ref|XP_019090509.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein B [Camelina sativa] ref|XP_019084530.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like [Camelina sativa] Length = 63 Score = 67.0 bits (162), Expect = 3e-12 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KKK F TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKSRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >gb|OAY36205.1| hypothetical protein MANES_11G003500 [Manihot esculenta] Length = 66 Score = 67.0 bits (162), Expect = 3e-12 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 111 KCFPRTKAKGERGFLEGCLFALCCCWLCEVCFD*NIKI 224 KC P +K KG+R FLEGCLFALCCCW+C++CFD + I Sbjct: 28 KCCPYSKPKGDRSFLEGCLFALCCCWICDLCFDTTVVI 65 >ref|NP_196028.2| cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gb|AED90694.1| cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] gb|OAO95527.1| hypothetical protein AXX17_AT5G03460 [Arabidopsis thaliana] Length = 63 Score = 66.6 bits (161), Expect = 4e-12 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KKK F TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|XP_002871075.1| cysteine-rich and transmembrane domain-containing protein A isoform X1 [Arabidopsis lyrata subsp. lyrata] gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 66.6 bits (161), Expect = 4e-12 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 99 KKKMKCFPRTKAKGERGFLEGCLFALCCCWLCEVCF 206 KKK F TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 29 KKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64