BLASTX nr result
ID: Rehmannia31_contig00025917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025917 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094331.1| pentatricopeptide repeat-containing protein ... 110 1e-25 ref|XP_012839715.1| PREDICTED: pentatricopeptide repeat-containi... 107 9e-25 gb|EYU35492.1| hypothetical protein MIMGU_mgv1a023380mg, partial... 107 1e-24 gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] 105 9e-24 gb|PIN25683.1| hypothetical protein CDL12_01562 [Handroanthus im... 104 1e-23 gb|PIN19489.1| hypothetical protein CDL12_07837 [Handroanthus im... 104 1e-23 gb|KZV53806.1| pentatricopeptide repeat-containing protein-like ... 100 4e-22 ref|XP_022899314.1| pentatricopeptide repeat-containing protein ... 92 3e-19 ref|XP_004305336.1| PREDICTED: pentatricopeptide repeat-containi... 89 7e-18 ref|XP_024188817.1| pentatricopeptide repeat-containing protein ... 85 1e-16 emb|CDP17813.1| unnamed protein product [Coffea canephora] 83 8e-16 ref|XP_008243575.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-15 emb|CDP21460.1| unnamed protein product, partial [Coffea canephora] 81 4e-15 ref|XP_020424248.1| pentatricopeptide repeat-containing protein ... 81 4e-15 ref|XP_023772360.1| pentatricopeptide repeat-containing protein ... 80 7e-15 ref|XP_008352649.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-14 ref|XP_023912658.1| pentatricopeptide repeat-containing protein ... 79 1e-14 ref|XP_021799966.1| pentatricopeptide repeat-containing protein ... 79 2e-14 ref|XP_019193801.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-14 ref|XP_019193795.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-14 >ref|XP_011094331.1| pentatricopeptide repeat-containing protein At2g36240 [Sesamum indicum] Length = 484 Score = 110 bits (274), Expect = 1e-25 Identities = 49/58 (84%), Positives = 56/58 (96%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 +++L+ SPIAITP++LLHFLKSRLRHHPTL HLDFHLFR+AATLDSFRHDHSTFEYMV Sbjct: 56 KTHLQKSPIAITPEDLLHFLKSRLRHHPTLSHLDFHLFRFAATLDSFRHDHSTFEYMV 113 >ref|XP_012839715.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Erythranthe guttata] Length = 486 Score = 107 bits (268), Expect = 9e-25 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 +S+LKN +AITPKELLHF KSRLRHHPTL HLDFHLFRYAA LDSFRHDH+TFEYM Sbjct: 58 RSFLKNGIVAITPKELLHFFKSRLRHHPTLSHLDFHLFRYAAALDSFRHDHTTFEYM 114 >gb|EYU35492.1| hypothetical protein MIMGU_mgv1a023380mg, partial [Erythranthe guttata] Length = 517 Score = 107 bits (268), Expect = 1e-24 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 +S+LKN +AITPKELLHF KSRLRHHPTL HLDFHLFRYAA LDSFRHDH+TFEYM Sbjct: 89 RSFLKNGIVAITPKELLHFFKSRLRHHPTLSHLDFHLFRYAAALDSFRHDHTTFEYM 145 >gb|EPS71349.1| hypothetical protein M569_03408 [Genlisea aurea] Length = 481 Score = 105 bits (261), Expect = 9e-24 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 ++Y+ SP+ ITP+ELL FLKSRLRHHPTL HLDFHLFRYAATLDSFRHDH+T EYMV Sbjct: 56 ETYVNKSPVTITPQELLRFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHTTLEYMV 113 >gb|PIN25683.1| hypothetical protein CDL12_01562 [Handroanthus impetiginosus] Length = 485 Score = 104 bits (260), Expect = 1e-23 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 +S+LK S IAIT K+LLHF KSRLR+HPTL HLD+HLFRYAATLDSFRHDHSTFEYMV Sbjct: 57 ESHLKKSRIAITSKDLLHFFKSRLRYHPTLSHLDYHLFRYAATLDSFRHDHSTFEYMV 114 >gb|PIN19489.1| hypothetical protein CDL12_07837 [Handroanthus impetiginosus] Length = 485 Score = 104 bits (260), Expect = 1e-23 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 +S+LK S IAIT K+LLHF KSRLR+HPTL HLD+HLFRYAATLDSFRHDHSTFEYMV Sbjct: 57 ESHLKKSRIAITSKDLLHFFKSRLRYHPTLSHLDYHLFRYAATLDSFRHDHSTFEYMV 114 >gb|KZV53806.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 481 Score = 100 bits (249), Expect = 4e-22 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = +1 Query: 175 FQSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 F+++LK +P +++P EL+HF+K+RLRHHP L HLDF+LFRYAATLDSFRHDHSTFEYM Sbjct: 56 FKTHLKENPTSLSPNELVHFMKTRLRHHPKLSHLDFYLFRYAATLDSFRHDHSTFEYM 113 >ref|XP_022899314.1| pentatricopeptide repeat-containing protein At2g36240 [Olea europaea var. sylvestris] ref|XP_022899316.1| pentatricopeptide repeat-containing protein At2g36240 [Olea europaea var. sylvestris] Length = 481 Score = 92.4 bits (228), Expect = 3e-19 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 +++LK +P ITP+ELLHF KS +RH+P L HLDFH FR+ AT DSFRHDHSTFEYM Sbjct: 54 KTHLKKNPTTITPQELLHFFKSHVRHNPILSHLDFHFFRFVATFDSFRHDHSTFEYM 110 >ref|XP_004305336.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Fragaria vesca subsp. vesca] Length = 479 Score = 88.6 bits (218), Expect = 7e-18 Identities = 38/58 (65%), Positives = 50/58 (86%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 ++++KN P+ TPK LLHFLKS+L HHPT HLDFH+F +A+T+DS+RHDHSTFE+MV Sbjct: 62 KTHIKNPPL--TPKTLLHFLKSKLHHHPTFTHLDFHVFNWASTVDSYRHDHSTFEWMV 117 >ref|XP_024188817.1| pentatricopeptide repeat-containing protein At2g36240 [Rosa chinensis] gb|PRQ43945.1| putative pentatricopeptide [Rosa chinensis] Length = 479 Score = 85.1 bits (209), Expect = 1e-16 Identities = 36/58 (62%), Positives = 49/58 (84%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 ++++KN P++ PK LLHFLKS+L HHPT H DFH+F +A+++DSFRHDHSTFE+MV Sbjct: 62 KTHIKNPPLS--PKTLLHFLKSKLHHHPTFTHFDFHVFNWASSVDSFRHDHSTFEWMV 117 >emb|CDP17813.1| unnamed protein product [Coffea canephora] Length = 479 Score = 82.8 bits (203), Expect = 8e-16 Identities = 38/58 (65%), Positives = 49/58 (84%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 +S+LK S TP++L+ FLKSR+ HHP + HLDFHLFRYAA+LD+FRHDHSTFE++V Sbjct: 56 KSHLKPS---FTPQDLVSFLKSRIHHHPGVTHLDFHLFRYAASLDTFRHDHSTFEWIV 110 >ref|XP_008243575.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Prunus mume] Length = 478 Score = 81.6 bits (200), Expect = 2e-15 Identities = 34/57 (59%), Positives = 47/57 (82%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 ++++KN P+ T + LLHFLKS+L HHPT H DFH+F +A+++DSFRHDHSTFE+M Sbjct: 62 KTHIKNPPL--TSQTLLHFLKSKLHHHPTFAHFDFHVFNWASSIDSFRHDHSTFEWM 116 >emb|CDP21460.1| unnamed protein product, partial [Coffea canephora] Length = 433 Score = 80.9 bits (198), Expect = 4e-15 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 +S+LK S TP++L+ FLKS + HHP + HLDFHLFRYAA+LD+FRHDHSTFE++V Sbjct: 53 KSHLKPS---FTPQDLVSFLKSHIHHHPGVTHLDFHLFRYAASLDTFRHDHSTFEWIV 107 >ref|XP_020424248.1| pentatricopeptide repeat-containing protein At2g36240 [Prunus persica] gb|ONH96146.1| hypothetical protein PRUPE_7G109800 [Prunus persica] Length = 506 Score = 80.9 bits (198), Expect = 4e-15 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 ++++KN P+ T LLHFLKS+L HHPT H DFH+F +A+++DSFRHDHSTFE+M Sbjct: 90 KTHIKNPPL--TSLNLLHFLKSKLHHHPTFAHFDFHVFNWASSIDSFRHDHSTFEWM 144 >ref|XP_023772360.1| pentatricopeptide repeat-containing protein At2g36240 [Lactuca sativa] gb|PLY78874.1| hypothetical protein LSAT_5X164841 [Lactuca sativa] Length = 482 Score = 80.1 bits (196), Expect = 7e-15 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = +1 Query: 181 SYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYMV 351 ++LKN+ +TP +LL FLK++L HHP HLD H+FR+A+TLDSFRHDHST+E+MV Sbjct: 60 THLKNN---LTPNDLLSFLKNQLHHHPKFAHLDLHVFRHASTLDSFRHDHSTYEWMV 113 >ref|XP_008352649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Malus domestica] ref|XP_008352650.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Malus domestica] ref|XP_008352651.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Malus domestica] ref|XP_008352652.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Malus domestica] ref|XP_017182513.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Malus domestica] Length = 483 Score = 79.3 bits (194), Expect = 1e-14 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 ++++KN P TP+ LLHFL+S+L HHP H DFH+F +A+++DSFRHDHSTFE+M Sbjct: 63 KTHIKNPPF--TPQTLLHFLQSKLHHHPAFTHFDFHVFNWASSVDSFRHDHSTFEWM 117 >ref|XP_023912658.1| pentatricopeptide repeat-containing protein At2g36240 [Quercus suber] Length = 493 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +1 Query: 211 TPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 TP LLHFLKS+L HHP+ H DFH+F +A+T+DSFRHDHSTFE+M Sbjct: 68 TPTHLLHFLKSKLHHHPSFTHFDFHIFNWASTIDSFRHDHSTFEWM 113 >ref|XP_021799966.1| pentatricopeptide repeat-containing protein At2g36240 [Prunus avium] Length = 478 Score = 79.0 bits (193), Expect = 2e-14 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = +1 Query: 178 QSYLKNSPIAITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 ++++KN P+ T + LLHFLK +L HHPT H DFH+F +A+++DSFRHDHSTFE+M Sbjct: 62 KTHIKNPPL--TSQALLHFLKCKLHHHPTFTHFDFHVFNWASSIDSFRHDHSTFEWM 116 >ref|XP_019193801.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X3 [Ipomoea nil] Length = 415 Score = 78.6 bits (192), Expect = 2e-14 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 205 AITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 + TPK+LL F++ + +HPTL HLDFHLFR+AA++DSFRHDHSTFE+M Sbjct: 56 SFTPKDLLSFIRKHIHYHPTLTHLDFHLFRHAASVDSFRHDHSTFEWM 103 >ref|XP_019193795.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X1 [Ipomoea nil] ref|XP_019193796.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X1 [Ipomoea nil] ref|XP_019193797.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X2 [Ipomoea nil] ref|XP_019193798.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X1 [Ipomoea nil] ref|XP_019193799.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X2 [Ipomoea nil] ref|XP_019193800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 isoform X2 [Ipomoea nil] Length = 472 Score = 78.6 bits (192), Expect = 3e-14 Identities = 32/48 (66%), Positives = 42/48 (87%) Frame = +1 Query: 205 AITPKELLHFLKSRLRHHPTLGHLDFHLFRYAATLDSFRHDHSTFEYM 348 + TPK+LL F++ + +HPTL HLDFHLFR+AA++DSFRHDHSTFE+M Sbjct: 56 SFTPKDLLSFIRKHIHYHPTLTHLDFHLFRHAASVDSFRHDHSTFEWM 103