BLASTX nr result
ID: Rehmannia31_contig00025884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025884 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07203.1| hypothetical protein CDL12_20238 [Handroanthus im... 75 2e-13 ref|XP_011074880.1| uncharacterized protein LOC105159499 [Sesamu... 68 5e-11 >gb|PIN07203.1| hypothetical protein CDL12_20238 [Handroanthus impetiginosus] Length = 327 Score = 75.1 bits (183), Expect = 2e-13 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -2 Query: 356 NNRGISGDYNNENGYSGNAFFAFPSYGGRWSGPTFSPGSFAGDYDSLDEEYFRGL 192 N RG+SG Y+ + G+ NAFF FP+YGG W+ P FSP + GDYDSLDEEYFR L Sbjct: 236 NYRGVSGGYDGD-GHLDNAFFRFPTYGGSWNNPGFSPDTSEGDYDSLDEEYFRRL 289 >ref|XP_011074880.1| uncharacterized protein LOC105159499 [Sesamum indicum] ref|XP_011074881.1| uncharacterized protein LOC105159499 [Sesamum indicum] ref|XP_020548229.1| uncharacterized protein LOC105159499 [Sesamum indicum] Length = 325 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -2 Query: 356 NNRGISGDYNNENGYSGNAFFAFPSYGGRWSGPTFSPGSFAGDYDSLDEEYFRGL 192 N+ GIS DY+ E+ + NA F FP+YGG W+GP FS SF GDYDS +EEY R L Sbjct: 234 NDPGISRDYD-EDDFLENAIFRFPAYGGSWNGPRFSADSFEGDYDSFNEEYLRRL 287