BLASTX nr result
ID: Rehmannia31_contig00025880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025880 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829711.1| PREDICTED: C-type lectin receptor-like tyros... 90 1e-17 gb|PIN17263.1| Receptor protein-tyrosine kinase [Handroanthus im... 82 3e-15 ref|XP_011096838.1| C-type lectin receptor-like tyrosine-protein... 75 1e-12 ref|XP_022859908.1| C-type lectin receptor-like tyrosine-protein... 59 4e-07 >ref|XP_012829711.1| PREDICTED: C-type lectin receptor-like tyrosine-protein kinase At1g52310 [Erythranthe guttata] gb|EYU43648.1| hypothetical protein MIMGU_mgv1a003917mg [Erythranthe guttata] Length = 555 Score = 89.7 bits (221), Expect = 1e-17 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = +2 Query: 335 MESKLAIYVQALALLFACLVVSLGASNSGFNGSFDASLMAPPLNQTQGKVACPSGWSS 508 MESKL I+VQ L LL +CL++SLGASNSGFN S D SLMAPPLNQT +V CPSGWSS Sbjct: 1 MESKLEIHVQTLTLLISCLLLSLGASNSGFNESLDTSLMAPPLNQTHTQVPCPSGWSS 58 >gb|PIN17263.1| Receptor protein-tyrosine kinase [Handroanthus impetiginosus] Length = 374 Score = 82.0 bits (201), Expect = 3e-15 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +2 Query: 335 MESKLAIYVQALALLFACLVVSLGASNSGFNGSFDASLMAPPLNQTQGKVACPSGWS 505 MESKL I+V+AL LL + ++S+GASNSGFN S DASL+A PLNQT KV+CPSGWS Sbjct: 1 MESKLMIHVEALKLLISYFLLSVGASNSGFNASLDASLIAAPLNQTHSKVSCPSGWS 57 >ref|XP_011096838.1| C-type lectin receptor-like tyrosine-protein kinase At1g52310 [Sesamum indicum] Length = 547 Score = 75.5 bits (184), Expect = 1e-12 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +2 Query: 344 KLAIYVQALALLFACLVVSLGASNSGFNGSFDASLMAPPLNQTQGKVACPSGWS 505 KLAI+ Q L LLF C ++SLGASNSGFN S D SL APPLNQ +V+CPSGWS Sbjct: 2 KLAIHFQPLILLF-CFLLSLGASNSGFNESLDVSLQAPPLNQIHSRVSCPSGWS 54 >ref|XP_022859908.1| C-type lectin receptor-like tyrosine-protein kinase At1g52310 [Olea europaea var. sylvestris] Length = 559 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +2 Query: 335 MESKLAIYVQA---LALLFACLVVSLGASNSGFNGSFDASLMAPPLNQTQGKVACPSGWS 505 ME K+AI+++ L LLF+C ++ LGASN GFN S D L A NQ++ + CPSGW Sbjct: 1 MEMKMAIFIELPLLLLLLFSCPLLRLGASNPGFNQSVDVYLTASSENQSRAQALCPSGWI 60 Query: 506 S 508 S Sbjct: 61 S 61