BLASTX nr result
ID: Rehmannia31_contig00025865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025865 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV40034.1| sufE-like protein 2, chloroplastic [Dorcoceras hy... 63 4e-09 >gb|KZV40034.1| sufE-like protein 2, chloroplastic [Dorcoceras hygrometricum] Length = 214 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 432 NTWHNVLSSMQKRTQDLV-EKEKGDQCFGAVVSSLVAVNGSCKET 301 N+WHNVL SMQKRT+DLV E+++ DQC SSL+ VNG+CKET Sbjct: 167 NSWHNVLISMQKRTRDLVKERDRKDQCMDEAFSSLIIVNGNCKET 211